KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi04229Help
Entry
BLi04229          CDS       T00200                                 

Gene name
dra
Definition
deoxyribose phosphate aldolase Dra (EC:4.1.2.4)
Orthology
K01619  
deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Pentose phosphate pathway
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bld00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4064650..4065321)
Genome map
AA seq 223 aa AA seqDB search
MTIANLIDHTALKPHTQKSEIKKLIEEAKAYQFASVCVNPTWVEFAAEELKGTEIDVCTV
IGFPLGANTTETKAFETKDAIAKGATEVDMVINIAALKDGNDDFVEADIRAVVEAAKGKA
LVKVIIETCLLTDEEKERACRLAVAAGADFVKTSTGFSTGGATAEDIALMRKTVGPDIGV
KASGGIRTKEDVETMISNGATRIGASAGVSIVSGAEGKNEDNY
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgcaaatctcattgatcatacagcattgaaaccgcatacacaaaaatccgag
attaagaaattaatagaagaagcgaaagcataccaattcgcttcagtctgcgtcaacccg
acatgggtcgaatttgccgccgaagagctgaagggaacggaaatcgacgtttgcacggtc
atcggttttccgctgggcgccaacacgacagagacaaaagcgtttgaaacaaaagacgct
atcgcaaaaggcgcgacagaggtggacatggtcatcaacatcgccgctttaaaagacgga
aacgatgactttgtcgaggccgacatccgcgcggtcgttgaagccgcaaaaggtaaagcg
cttgttaaagtcatcattgaaacgtgtctgttgacagacgaagaaaaagagcgcgcctgc
cgcctggctgttgctgccggtgccgactttgtcaaaacctcaaccgggttctcaaccggc
ggagcgacagcggaagatatcgccctgatgcggaaaaccgtcggacctgacatcggtgtc
aaagcatccggagggattcgtacaaaagaggacgttgaaaccatgatctcaaacggcgcg
acccggatcggtgcaagcgcaggcgtttccatcgtcagcggagcagaaggaaaaaatgaa
gataactactaa

DBGET integrated database retrieval system