KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi04290Help
Entry
BLi04290          CDS       T00200                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BLi04290
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLi04290
   00620 Pyruvate metabolism
    BLi04290
   00650 Butanoate metabolism
    BLi04290
  Lipid metabolism
   00071 Fatty acid degradation
    BLi04290
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLi04290
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLi04290
   00626 Naphthalene degradation
    BLi04290
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLi04290
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BLi04290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4137609..4140212
Genome map
AA seq 867 aa AA seqDB search
MAIEEKNMKQKQNASNMIDQLVEKGLKALEEFRSFDQEQIDEIVKQMALAGLDQHMPLAK
LAVEETKRGVYEDKIIKNMFATEYVYHHIKYDKTVGIINENEHDGVIEIAEPVGVIAGVT
PVTNPTSTTMFKSLISIKTRNPIVFAFHPSAQKCSREAARILRDAAVKAGAPDNCIQWIE
TPSLDATQALMTHPNVSLILATGGAGMVKSAYSSGKPALGVGPGNVPCYIEKSANLKQAV
NDLILSKTFDNGMICASEQAVIIDKGIYSDVKAEMTRNNCYFLNKTEKSKVEKLVINENT
CAVNADIVGMPAFKIAEMAGIKVPQDTKILIAELEGVGPDDPLSREKLSPVLACYKVSGL
EEGLKRAEEMLAFGGTGHSAVIHTNDQEAVKEFGLRMKAGRIIVNAPSSQGAIGDIYNAY
MPSLTLGCGTYGGNSVSSNVGAVHLINTKKVAKRNVNMQWFKVPPKIYFEKHATQYLAKM
PDISKAFIVTDPGMVKLGYVDRALHYLRRRPDYVHCEIFSDVEPDPSIETVMNGVDMMAK
FQPDVIIALGGGSAMDAAKGMWMFYEHPDAEFFGLKQKFLDIRKRIVKYPKLGGKAKFVA
IPTTSGTGSEVTSFSVITDKETNTKYPLADYELTPDVAIIDPQFVMTVPKHITADTGMDV
LTHAIESYVSCMANDYTDGLAMKAIQLIFEYLPRAYKNGSDELAREKVHNASTIAGMAFS
NAFLGINHSLAHKLGAEFQIAHGRANAILLPHVIRYNAAKPKKFTAFPKYSHFIADQRYA
EIARTLGLPAKTTAEGVESLIQEIISLAKELKIPMSIKQNGVDAAAFESKVDLMAERAFE
DQCTTANPKLPLVSELAEIYRSAYKGV
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaagaaaagaacatgaaacaaaagcaaaatgcctcaaacatgattgatcag
ctagtcgaaaaaggcctaaaggcattggaagaattccgcagctttgatcaggagcagatt
gatgagatcgtcaaacagatggcgcttgccggccttgatcagcacatgcctctcgccaaa
cttgccgtcgaagaaacgaagcgcggcgtttatgaagataaaatcattaaaaacatgttt
gccacagagtatgtctaccatcatatcaaatacgataaaacagtgggcatcatcaatgaa
aacgaacacgacggagtcattgaaatcgcggagcctgtcggtgtcatcgccggcgtgacg
ccggtgaccaaccctacttccaccaccatgttcaagtccctgatatcaattaaaacaaga
aatccaatcgtgtttgctttccatccatccgcccaaaaatgcagccgcgaagcggcgaga
atccttcgggacgcagccgtcaaagcaggagcacccgacaactgcatccaatggatcgag
acgccttctctggatgcaacgcaagccctaatgacccacccgaacgtttccctgatcctc
gcaacaggaggcgcaggcatggtgaaatccgcttacagctccggaaaaccggcccttggc
gtcggacctggaaacgttccgtgctacatcgagaagtctgccaacctgaagcaagccgtc
aatgatctgatcttatccaaaacatttgacaacggcatgatttgcgcatcagagcaggcc
gtcatcatagacaaaggcatctactcagacgtcaaagccgaaatgacaagaaacaactgc
tatttcttaaataaaaccgaaaaatcaaaggtcgaaaaattggtcatcaatgaaaatact
tgcgcggtaaacgctgatatcgtcggcatgccggcattcaaaattgctgaaatggccggt
atcaaagtgccgcaagatacaaaaatcctcatcgccgaattagaaggtgtaggtccggat
gacccgctgtccagagaaaaactgagccctgttttagcgtgctacaaagtcagcgggctt
gaagaaggattaaaacgcgccgaagagatgctggcgttcgggggaaccggccactcggcg
gtgattcatacgaacgatcaagaagccgttaaagaattcggcttaaggatgaaggccggc
cggatcattgtcaatgcaccgtcgtcacaaggagcgatcggcgacatttacaacgcctat
atgccttctttaacgctcggctgcggcacatatggcgggaactccgtctcgtcaaacgta
ggggccgttcatttaatcaacacgaaaaaagtggcgaaaaggaatgtcaatatgcagtgg
tttaaagtgcctccaaaaatctattttgaaaaacacgcaacccaatatttagcgaaaatg
cctgacatctcaaaagcgtttattgtgactgatccgggaatggtgaaactcggatatgta
gaccgcgcccttcactacttaagaaggcgcccggattacgttcattgcgaaattttttct
gatgtcgagcctgatccttcaatcgaaacggtgatgaacggcgtcgacatgatggccaaa
ttccagccggatgtcatcatcgccctcggcggaggttcggcaatggatgccgcaaaagga
atgtggatgttctacgagcaccctgatgctgaattctttggcttaaagcaaaaatttctg
gacatccgcaagcgcatcgtcaaatacccgaaactgggaggaaaagcaaaattcgtcgca
atcccgacgacatcaggcacaggttctgaagtcacttcattctctgtcattacagacaaa
gaaacgaatacaaagtacccgctggccgattatgaattaacaccggatgtcgcgatcatt
gacccgcaatttgtcatgaccgtgccgaaacatatcacggccgacacaggaatggacgta
ttgacacacgcaattgaatcatacgtatcgtgcatggccaacgactatactgacggcttg
gccatgaaggccatccagctgatcttcgaatatctgccaagagcatacaaaaacggcagc
gacgagctggcccgcgaaaaagtgcataatgcatcaacgattgccggaatggcattttcc
aatgccttcctcggcatcaaccacagcttagcccataagcttggcgccgagtttcagatc
gctcatggacgggcaaacgccatccttctgccgcacgtgatccgctataatgcagcgaag
ccgaaaaagttcacggcatttcctaaatacagccacttcatagccgaccagcgctacgcg
gagattgccagaacgctcggcctgcctgcaaaaacaactgcagaaggtgttgaaagcctc
atccaggagatcatctcgcttgccaaagagcttaaaattccgatgagcattaaacaaaac
ggcgtggatgccgccgcattcgaaagcaaagtagatctcatggccgagcgcgcctttgaa
gatcagtgcacgacagccaatcctaagctgccgctcgtttcagagctggctgagatttac
cgttccgcgtataaaggagtttag

DBGET integrated database retrieval system