KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0104Help
Entry
BLIF_0104         CDS       T01420                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(134884..137121)
Genome map
AA seq 745 aa AA seqDB search
MTDAYGNDAATSTGTIADTTNNAASGAPQRAESTERLARPLIKLAKACGLATSFIDQLGT
YTEISDAALVAVLKALDVDASSDEAIARSMTQLEVENSKRLLPSTIVATTGKPTGITLNC
SSDADITASIELEDGTAFGHFALLPNLNSGKPDLTIAPDLPMGYHTLTVTVDGREGKAAI
IAAPARIPVPEAVAEHQRWGWMTQMYSVRSRESWGIGDYGDLKRLLADAAEKSKADFMLI
NPIHAGAPIPPLEPSPYLPESRRFLNVTYIRPQDIPEYATLPADVRAQVDALHDSVAARN
DESTPMDINAAWEAKRPALRLIFEAGRNNKRELEFEHFKTTAGPDLDSFATWCLCFEVWG
APWGENRWFFEKTIDDPAVRQLVEEHHDLFEFNRWLQWIAAEQVNAAQQEALDHGMTLGL
MQDMAVGVHGLGADAWANPERFASGGVTVGCPPDFYNQQGQDWGQPPFNPRYLEATGYQV
YREMVHSMYEHAGAVRIDHVLGLFRLWWIPQGLGARNGAYVTYNHEAMLGVLAIEATRAG
GMVVGEDLGTVPDYVRRILADHGVLGTDVEWFNRVDDSPNAGDPYRAPKDYRKQALASVT
THDLPPTAGYLNFAHVKLREELHLLSEPVEAFAASAMAERTAMMNRLVENGYISQTVADD
VEGHVQEIVEAMHAMLTDTPSLLLQAALVDGVGECRSQNQPGTSREYSNWRVPLADSSGH
VVHTDEVFDLPRVQSLAAVMRREKR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcatacggcaacgacgcagcaaccagcaccggcaccatcgcagacaccacc
aacaacgccgcttccggtgccccgcagcgcgcggaaagcacggaacgactcgcccgcccg
ctcatcaagctcgccaaagcctgcggacttgccacctcattcatcgaccagctcggcacc
tacaccgaaatcagcgacgcggccttggtcgccgtactcaaggccctcgacgtggacgca
tccagcgacgaggccatcgcacgctccatgacccaacttgaggtggaaaacagcaaacgt
ttgctcccctccaccatcgtcgccaccaccggcaaaccgaccggcatcaccctgaactgc
tcgtcggacgcggacatcaccgcctccatcgaactggaggacggcaccgcgtttggccac
tttgccctgctgccgaacctcaattccggcaagccggacttgaccatcgcacccgacctg
ccgatgggttaccacacgctgaccgtcacggttgacgggcgcgagggcaaggcggccatc
atcgccgcccccgcgcgcattcccgtgccggaggcggtcgccgagcaccagcggtggggc
tggatgacgcagatgtattccgtgcggtcccgcgaatcgtggggcatcggcgattacggc
gatctgaagcgtcttttggcagatgccgccgagaagtccaaggccgacttcatgctcatc
aatccgattcacgccggcgcgccgattccgccgcttgagccatcgccgtatctaccggaa
tcgcgccgattcctcaacgtgacgtacatccggccgcaggatatccccgaatatgccaca
ctgccggccgacgtgcgcgcgcaggtggatgcgctgcatgattcggtggccgcgcgcaac
gacgaatcgaccccgatggacatcaacgcggcgtgggaggccaagcgcccggcgctgcgc
ctgatcttcgaagcgggccgcaacaacaagcgcgagctcgaattcgagcatttcaagacc
accgccggcccggacctcgattccttcgccacatggtgcctgtgcttcgaggtatggggc
gcgccgtggggcgagaaccgttggttcttcgagaagaccatcgacgacccggccgtgcgc
cagctcgtcgaggagcaccacgacctgttcgagttcaaccgctggctgcagtggatcgct
gccgagcaggtgaacgccgcgcagcaggaggcgctggaccacggcatgacgctggggctg
atgcaggacatggccgtgggcgtgcacgggctcggcgcggatgcctgggccaatccggaa
cgcttcgcctcaggtggcgtcacggtcggctgcccgccggacttctataaccagcagggc
caggattggggccagccaccgttcaacccgcgctacctggaggccaccggctaccaggtg
taccgcgagatggtgcattcgatgtacgagcacgcgggcgcggtgcgcatcgaccatgtg
ctgggcttgttccgcctgtggtggattccgcaggggctcggtgcccgcaacggcgcatac
gtgacgtacaaccacgaggcgatgttgggagtactggccatcgaggccacgcgcgccgga
ggcatggtggttggcgaggatctgggcaccgtaccggattacgtgcgccgcattctggcc
gatcacggcgtgctcggcactgacgtggaatggttcaaccgcgtggacgattcgccgaac
gccggcgacccgtaccgcgcacccaaggactatcgcaaacaggcattggcctcggtgacc
acgcacgatctgccacccaccgccggctacctgaacttcgcacacgtcaagctgcgcgag
gagctgcatctcctgagcgagccggtggaggcattcgccgcctcggcgatggccgagcgc
acggccatgatgaaccgtctggtggagaacggctatatctcgcagaccgtggcggatgat
gtggaaggccatgtgcaggaaatcgtggaagcgatgcacgccatgctcaccgatacgccg
tcgctgctgctgcaggcagcgctggtggacggcgtgggcgaatgccgctcccagaatcag
ccgggcacttccagagagtattcgaactggcgcgtgccgctggcggacagctcaggccac
gtggtacataccgacgaggtcttcgacctgccacgcgtgcagtccctagccgccgtgatg
cgccgagagaagcggtga

DBGET integrated database retrieval system