KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0130Help
Entry
BLIF_0130         CDS       T01420                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:blf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLIF_0130
DNA repair and recombination proteins [BR:blf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BLIF_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
165174..165776
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDAFGRLPGIGPKGAQRIAFYMLSAPEDEARDLAEAIEEVKAKIRFCD
ICGNVCESSPCPVCADPRRDRSVICVVEEPKDVMSIERTREYHGLYHVLGGAINPMANVG
PADLRIPGLLKRLEGDEVKEVIMALDPNIEGEATTSYLTQLLRPVGVKVTRLASGLPVGS
DLEYADEITLGRALAGRREA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcttatgacggcgcaatacaacgactgatcgacgctttcgggcggctgccc
ggcatcgggccgaagggcgcgcagcgtatcgccttctacatgctgtccgcgcccgaagat
gaagcgcgcgatttggccgaggccatcgaagaggtcaaggccaagatccgcttctgtgat
atttgcggcaacgtgtgcgaatccagcccctgcccggtatgcgccgacccgagacgcgac
cgttcggtgatctgcgtggtcgaagagcccaaggatgtgatgagcatcgagcgcacgcgc
gaataccacggcctataccatgtgctcggcggcgcaatcaacccaatggccaacgttggc
cctgccgacctgcgtattcccggtctgctcaaacgcttagaaggcgatgaggtcaaggaa
gtgattatggcgctcgacccgaatattgaaggcgaggccaccaccagctacttgacccag
ctattgcgacccgtaggtgtcaaggtcacccgacttgccagcggcctgccggtgggctcc
gacttggagtatgccgacgaaatcacgctgggcagggcactggccggtcggcgcgaggcc
taa

DBGET integrated database retrieval system