KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0351Help
Entry
BLIF_0351         CDS       T01420                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:blf00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448536..450668
Genome map
AA seq 710 aa AA seqDB search
MTTHRAFRWPSLLTESGRGIAFGGDYNPDQWPEETLDEDIRLMGEAGVNVVSLAIFSWDK
IEPVEGAFTFEWLDHVIDRLGRAGIAVDLASATAAAPLWLYESHPEVLPVDRYGHTVNAG
SRQSWQPTSPVFKEYALRLCRKLAEHYKDNPYVTAWHMGNEYGWNNRYDYSDNALAAFRT
WCEAKYGTIDALNEAWGTAFWSQHVNSFDEVLLPRHMGGDAMVNPSQQLDYERFGNDMLL
DFYKAERDAIEQICPDKPFTTNFMVSTDQCVMNYAKWADEVDFVSNDHYFHEGESHLDEL
ACSDALMDSLALGKPWYVMEHSTSAVQWKPLNTRKRAGELMRDSLAHVAMGADAICFFQW
RQSKSGAEAFHSAMLPHAGADSKVFRGVCELGKALKTLSDAGLQGTELERAGTAILFSAE
SEWATRSETLPSMKLNHWHDVRDWYRGFLDAGLRADVVPLAYDWTGYKTIVLPTVLSLSD
EDVLRIADFAKAGGTVIVGYAAGLIDEHFHIGLGGYPGAGNGLLRDMLGIRSEEFNILGE
EAEGEPSEISLSNGLTTRLWQNDVTSVAADTTVLASYAGESAADWELERTPAITSRPYGN
GTAIYVGCDLNRHDIAQLLKALGSRWQELSAQPTESGQTPTYPTTDPRILHTIRRSADGS
TRFDFYLNRSNQPVAINGVEGDPIIAHRCETDAVGYTLNRNAILIAKTSC
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgactactcatagagcatttaggtggccgtccctgctgacggaatccggccgcggcatc
gcgttcggcggcgactacaacccggaccagtggcccgaggagacgctggacgaggatatc
cgtctcatgggtgaggccggcgtgaacgtcgtatcgctggcaattttcagctgggacaag
atcgagccggtcgagggcgcgttcacgttcgagtggctcgaccatgtgatcgacaggctc
ggcagagccggcatcgccgtggacttggcctccgccacagccgccgcgccgctgtggctg
tacgaatcccatccagaggtgctgccggtagaccggtatggtcataccgtcaacgcgggc
tcacgccagtcgtggcagcccacaagcccggtgttcaaggaatacgcgctgcgcctgtgc
cgcaaacttgccgaacactacaaggacaacccgtatgtgaccgcctggcacatgggcaac
gaatacggctggaacaaccgctacgactactccgacaacgccttggccgcgttccgcacg
tggtgcgaggccaagtacggtaccatcgacgcgttgaacgaggcgtggggcacggccttc
tggtcgcagcacgtgaacagtttcgacgaggtgctgctgccacgtcacatgggcggcgac
gccatggtcaacccgtcgcagcagttggattacgagcggttcggcaacgacatgctgctc
gacttctacaaagccgaacgcgacgccatcgagcagatctgccccgacaagccgttcacc
acgaacttcatggtctccaccgaccagtgcgtcatgaactacgccaaatgggcggatgag
gtggacttcgtgtccaacgatcactacttccatgagggcgaatcccacctggacgaactc
gcctgctcggacgcgctcatggactccctcgcgctgggcaagccgtggtacgtgatggag
cactccacctcagccgtgcagtggaagccgctgaacacacgcaaacgggccggcgaactc
atgcgcgactccctggcccacgtggccatgggcgccgacgccatctgctttttccaatgg
cggcaatccaagtcgggtgccgaggcgttccactccgccatgctgccccacgcgggcgcc
gattccaaggtcttccgcggcgtatgcgagctcggtaaggcgctgaagaccctctccgac
gccgggctgcagggcactgagctcgagcgtgccggcacggcgatcctgttcagcgcggaa
tccgaatgggccacacgctccgaaaccctgcccagcatgaaactcaaccactggcacgac
gtgcgcgactggtaccgcggcttcctggatgccgggctgcgcgcggacgtggtgccgctc
gcctacgactggaccggctacaaaaccatcgtgctgcccaccgtgctcagcctgtccgac
gaagacgttctccgtatcgccgacttcgcgaaggccggcggaaccgtcatcgtcggctat
gccgccggcctgatcgacgagcacttccacatcggcctcggcggctaccccggcgccggc
aacgggctcctacgcgacatgctcggcatccgctccgaagaattcaacatcctcggtgaa
gaagccgaaggcgagcccagcgaaatcagcctgtccaatggtctgacgacccgcctgtgg
cagaacgacgtgacttccgtagccgcagacaccacagtgcttgcctcttacgcaggtgag
tccgccgccgactgggagctggagcgcacccccgccatcaccagccgcccctatggcaac
ggtaccgccatctacgtgggctgcgacctcaaccgtcacgacattgcccagttgctcaaa
gcacttggctcccgatggcaggagttgtcggcgcagccgactgagagtggtcaaactcca
acctatcccaccacagatccccgcatcctgcacaccatccgccgatccgcagacggctcc
acccgcttcgatttctacctcaaccgctcaaaccagcccgtcgccatcaacggtgtggaa
ggtgatcccatcatcgcccaccgttgcgagactgacgccgttggatatacgctgaaccgc
aacgccattcttatcgctaaaacgtcctgctaa

DBGET integrated database retrieval system