KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0351Help
Entry
BLIF_0351         CDS       T01420                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLIF_0351
Enzymes [BR:blf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BLIF_0351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448536..450668
Genome map
AA seq 710 aa AA seqDB search
MTTHRAFRWPSLLTESGRGIAFGGDYNPDQWPEETLDEDIRLMGEAGVNVVSLAIFSWDK
IEPVEGAFTFEWLDHVIDRLGRAGIAVDLASATAAAPLWLYESHPEVLPVDRYGHTVNAG
SRQSWQPTSPVFKEYALRLCRKLAEHYKDNPYVTAWHMGNEYGWNNRYDYSDNALAAFRT
WCEAKYGTIDALNEAWGTAFWSQHVNSFDEVLLPRHMGGDAMVNPSQQLDYERFGNDMLL
DFYKAERDAIEQICPDKPFTTNFMVSTDQCVMNYAKWADEVDFVSNDHYFHEGESHLDEL
ACSDALMDSLALGKPWYVMEHSTSAVQWKPLNTRKRAGELMRDSLAHVAMGADAICFFQW
RQSKSGAEAFHSAMLPHAGADSKVFRGVCELGKALKTLSDAGLQGTELERAGTAILFSAE
SEWATRSETLPSMKLNHWHDVRDWYRGFLDAGLRADVVPLAYDWTGYKTIVLPTVLSLSD
EDVLRIADFAKAGGTVIVGYAAGLIDEHFHIGLGGYPGAGNGLLRDMLGIRSEEFNILGE
EAEGEPSEISLSNGLTTRLWQNDVTSVAADTTVLASYAGESAADWELERTPAITSRPYGN
GTAIYVGCDLNRHDIAQLLKALGSRWQELSAQPTESGQTPTYPTTDPRILHTIRRSADGS
TRFDFYLNRSNQPVAINGVEGDPIIAHRCETDAVGYTLNRNAILIAKTSC
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgactactcatagagcatttaggtggccgtccctgctgacggaatccggccgcggcatc
gcgttcggcggcgactacaacccggaccagtggcccgaggagacgctggacgaggatatc
cgtctcatgggtgaggccggcgtgaacgtcgtatcgctggcaattttcagctgggacaag
atcgagccggtcgagggcgcgttcacgttcgagtggctcgaccatgtgatcgacaggctc
ggcagagccggcatcgccgtggacttggcctccgccacagccgccgcgccgctgtggctg
tacgaatcccatccagaggtgctgccggtagaccggtatggtcataccgtcaacgcgggc
tcacgccagtcgtggcagcccacaagcccggtgttcaaggaatacgcgctgcgcctgtgc
cgcaaacttgccgaacactacaaggacaacccgtatgtgaccgcctggcacatgggcaac
gaatacggctggaacaaccgctacgactactccgacaacgccttggccgcgttccgcacg
tggtgcgaggccaagtacggtaccatcgacgcgttgaacgaggcgtggggcacggccttc
tggtcgcagcacgtgaacagtttcgacgaggtgctgctgccacgtcacatgggcggcgac
gccatggtcaacccgtcgcagcagttggattacgagcggttcggcaacgacatgctgctc
gacttctacaaagccgaacgcgacgccatcgagcagatctgccccgacaagccgttcacc
acgaacttcatggtctccaccgaccagtgcgtcatgaactacgccaaatgggcggatgag
gtggacttcgtgtccaacgatcactacttccatgagggcgaatcccacctggacgaactc
gcctgctcggacgcgctcatggactccctcgcgctgggcaagccgtggtacgtgatggag
cactccacctcagccgtgcagtggaagccgctgaacacacgcaaacgggccggcgaactc
atgcgcgactccctggcccacgtggccatgggcgccgacgccatctgctttttccaatgg
cggcaatccaagtcgggtgccgaggcgttccactccgccatgctgccccacgcgggcgcc
gattccaaggtcttccgcggcgtatgcgagctcggtaaggcgctgaagaccctctccgac
gccgggctgcagggcactgagctcgagcgtgccggcacggcgatcctgttcagcgcggaa
tccgaatgggccacacgctccgaaaccctgcccagcatgaaactcaaccactggcacgac
gtgcgcgactggtaccgcggcttcctggatgccgggctgcgcgcggacgtggtgccgctc
gcctacgactggaccggctacaaaaccatcgtgctgcccaccgtgctcagcctgtccgac
gaagacgttctccgtatcgccgacttcgcgaaggccggcggaaccgtcatcgtcggctat
gccgccggcctgatcgacgagcacttccacatcggcctcggcggctaccccggcgccggc
aacgggctcctacgcgacatgctcggcatccgctccgaagaattcaacatcctcggtgaa
gaagccgaaggcgagcccagcgaaatcagcctgtccaatggtctgacgacccgcctgtgg
cagaacgacgtgacttccgtagccgcagacaccacagtgcttgcctcttacgcaggtgag
tccgccgccgactgggagctggagcgcacccccgccatcaccagccgcccctatggcaac
ggtaccgccatctacgtgggctgcgacctcaaccgtcacgacattgcccagttgctcaaa
gcacttggctcccgatggcaggagttgtcggcgcagccgactgagagtggtcaaactcca
acctatcccaccacagatccccgcatcctgcacaccatccgccgatccgcagacggctcc
acccgcttcgatttctacctcaaccgctcaaaccagcccgtcgccatcaacggtgtggaa
ggtgatcccatcatcgcccaccgttgcgagactgacgccgttggatatacgctgaaccgc
aacgccattcttatcgctaaaacgtcctgctaa

DBGET integrated database retrieval system