KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0541Help
Entry
BLIF_0541         CDS       T01420                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
blf00010  Glycolysis / Gluconeogenesis
blf00071  Fatty acid degradation
blf00350  Tyrosine metabolism
blf00625  Chloroalkane and chloroalkene degradation
blf00626  Naphthalene degradation
blf01100  Metabolic pathways
blf01110  Biosynthesis of secondary metabolites
blf01120  Microbial metabolism in diverse environments
blf01130  Biosynthesis of antibiotics
blf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIF_0541
  Lipid metabolism
   00071 Fatty acid degradation
    BLIF_0541
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLIF_0541
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLIF_0541
   00626 Naphthalene degradation
    BLIF_0541
Enzymes [BR:blf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLIF_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: BAJ70684
UniProt: E8MSE0
Position
698588..699631
Genome map
AA seq 347 aa AA seqDB search
MSETMKAAIFVEPGKMTVEEVPKAALQQDDDIVIRMVRTCVCGSDLWFFRGLSGQAAHSQ
VGHEAIGVVEETGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFESVCPHGGYFSACQAEY
LRVPEADGTVVKVPGSPEDYSDEQLASLLTISDVMSTGYHAAVSAEVKPGDTAVVMGDGA
VGLCGVIAAKMRGATRIIAMSRHEDRAALAREFGATDIVPERGQEAIDKVLEMTGGYGAD
AVLECVGSKQSFDTAIGLIRRGGVIGRVGLPHDVEISAEGTFYGNIGIKGGPAPVRHYDL
DEGLLDAVLKGEINPGRVFTAEYDLDHIQDAYEAMDQRKVIKALIRF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccatgaaagccgcgattttcgttgagcctggcaagatgaccgtggaagaa
gtgccaaaggcggcacttcagcaggatgatgacatcgtgattcgcatggtgcgcacctgt
gtatgcggctctgatttgtggttcttccgtgggctgagcggacaggccgcacacagtcag
gtgggccacgaagccattggcgtggtcgaggagactggcgcggcggtcgaatccgttaag
ccaggtgatttcgtggtcgtgccattcccgtacagctgcggcaagtgcccggtatgcaag
gccggcttcgaatccgtgtgcccgcacgggggctacttctccgcttgtcaggccgaatac
ctgcgtgtgcccgaggcggacggcaccgtggtcaaggtgcccggttcaccggaagattat
tccgatgaacagctcgcatcgctgctgaccatttccgatgtgatgtccaccggttatcac
gcggcggtttctgccgaggtcaagcccggtgacacagccgtggtcatgggcgatggtgca
gtcggcctgtgcggtgtgattgccgccaagatgcgtggtgccacgcgcattattgccatg
agccgtcacgaggatcgcgcggcgctcgcccgcgaattcggtgcgactgatatcgtgccc
gagcgtggccaagaggctattgacaaggtgctggagatgaccggtggctatggtgcggac
gcggtgctcgaatgcgtgggctccaagcagtccttcgacacggcgattggcctgattcgc
cgcggtggcgtgattggtcgtgtgggtctgccgcacgacgtggagatcagcgccgaaggc
acgttctacggcaacatcggcatcaagggcggcccggctcccgtgcgccactatgacctt
gatgagggtctgctggacgcggtgctcaagggcgagatcaaccccggccgcgtgttcacc
gccgagtacgacctcgaccatatccaggacgcctacgaggcgatggaccagcgcaaggtc
atcaaggcgctgatccggttctag

DBGET integrated database retrieval system