KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0541Help
Entry
BLIF_0541         CDS       T01420                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BLIF_0541
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIF_0541
  Lipid metabolism
   00071 Fatty acid degradation
    BLIF_0541
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLIF_0541
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLIF_0541
   00626 Naphthalene degradation
    BLIF_0541
Enzymes [BR:blf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLIF_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
698588..699631
Genome map
AA seq 347 aa AA seqDB search
MSETMKAAIFVEPGKMTVEEVPKAALQQDDDIVIRMVRTCVCGSDLWFFRGLSGQAAHSQ
VGHEAIGVVEETGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFESVCPHGGYFSACQAEY
LRVPEADGTVVKVPGSPEDYSDEQLASLLTISDVMSTGYHAAVSAEVKPGDTAVVMGDGA
VGLCGVIAAKMRGATRIIAMSRHEDRAALAREFGATDIVPERGQEAIDKVLEMTGGYGAD
AVLECVGSKQSFDTAIGLIRRGGVIGRVGLPHDVEISAEGTFYGNIGIKGGPAPVRHYDL
DEGLLDAVLKGEINPGRVFTAEYDLDHIQDAYEAMDQRKVIKALIRF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccatgaaagccgcgattttcgttgagcctggcaagatgaccgtggaagaa
gtgccaaaggcggcacttcagcaggatgatgacatcgtgattcgcatggtgcgcacctgt
gtatgcggctctgatttgtggttcttccgtgggctgagcggacaggccgcacacagtcag
gtgggccacgaagccattggcgtggtcgaggagactggcgcggcggtcgaatccgttaag
ccaggtgatttcgtggtcgtgccattcccgtacagctgcggcaagtgcccggtatgcaag
gccggcttcgaatccgtgtgcccgcacgggggctacttctccgcttgtcaggccgaatac
ctgcgtgtgcccgaggcggacggcaccgtggtcaaggtgcccggttcaccggaagattat
tccgatgaacagctcgcatcgctgctgaccatttccgatgtgatgtccaccggttatcac
gcggcggtttctgccgaggtcaagcccggtgacacagccgtggtcatgggcgatggtgca
gtcggcctgtgcggtgtgattgccgccaagatgcgtggtgccacgcgcattattgccatg
agccgtcacgaggatcgcgcggcgctcgcccgcgaattcggtgcgactgatatcgtgccc
gagcgtggccaagaggctattgacaaggtgctggagatgaccggtggctatggtgcggac
gcggtgctcgaatgcgtgggctccaagcagtccttcgacacggcgattggcctgattcgc
cgcggtggcgtgattggtcgtgtgggtctgccgcacgacgtggagatcagcgccgaaggc
acgttctacggcaacatcggcatcaagggcggcccggctcccgtgcgccactatgacctt
gatgagggtctgctggacgcggtgctcaagggcgagatcaaccccggccgcgtgttcacc
gccgagtacgacctcgaccatatccaggacgcctacgaggcgatggaccagcgcaaggtc
atcaaggcgctgatccggttctag

DBGET integrated database retrieval system