KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0602Help
Entry
BLIF_0602         CDS       T01420                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:blf01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:blf00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:blf00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(763312..764802)
Genome map
AA seq 496 aa AA seqDB search
MTTTFHSTRSTTDSLTAKQAIRKGIADDGGLFVSDALGKTKVDVASLPGKSYQQIAAEVL
GALLPDFTAEELGQCIADAYGEQWSDERITPLKPLGDDYVLELFNGPTSAFKDVALQILP
RFMAHTTPADGDADEKIMILTATSGDTGKAALAGFADAPGTAITVFYPEGKVSQVQELQM
TTQAGSNVQVAAVEGNFDDAQSAVKRIFGDRALAERLAGNSHVVLSSANSINVGRLVPQV
VYYFSAYAQLLADQVINVGDEVEFVVPTGNFGDILAGYYAKLLGLPVKHLVVASDKNNVL
FDFLTTGTYNRQRPFFQTISPSMDILISSNLERMLYYLSEGDTRLISMLMNDLNKWGTYE
IPEELLAKIRQIFGTGWADEDQVRESIKHCWDENHYVIDPHTACGYYLLEQMPRDPLTPR
VLLSTASPYKFPRVVNEALGFDATGTDFECMDVLAHETGTTAPAALRGLETADVRFKDVV
AIDGMEDYVEKAAQAL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccaccttccattccacccgtagcaccaccgattcgctgaccgccaagcaggcg
attcgtaagggcatcgccgatgacggcggcctgttcgtttcggacgcgttgggcaagacc
aaggtggacgtggcctccctgccgggcaagtcgtaccagcaaatcgccgccgaggtgctg
ggcgcgctgctgccggacttcacggccgaggagctgggccagtgcatcgccgacgcctac
ggcgaacagtggtccgacgagcgcatcaccccgctcaagcccctgggcgacgattacgtg
ctcgaactgttcaacggcccgacttccgcgttcaaggacgtggcgctgcagatcctgccg
cgcttcatggcgcacaccacgccggccgatggcgacgcggacgagaagatcatgatcctc
accgccacctccggcgacaccggcaaggccgcgctggccggcttcgcggacgccccgggc
accgcgatcaccgtcttctacccggaaggcaaggtctcccaggtccaggagctgcagatg
accacgcaagccggctccaacgtgcaggtggccgccgtggaaggcaacttcgacgacgcc
cagtccgcggtcaagcgcatcttcggcgaccgcgccctggccgagcgtctcgccggcaat
tcgcacgtggtgctttcctccgccaactccatcaacgtgggccgtctggtgccgcaggtc
gtctactacttctccgcttacgcccaactgctcgccgaccaggtgatcaacgtcggcgat
gaggtcgagtttgtggtcccgaccggcaacttcggcgatatcctcgccggctactatgcc
aagctgctcggtctgccggtcaagcacctcgtggtggcttccgacaagaacaacgtgctg
ttcgacttcctgaccaccggtacctacaaccgccagcgcccgttcttccagaccatctcc
ccctcgatggacatcctcatctcctccaacctggagcgcatgctgtactacttgtccgag
ggcgacacccgtctgatctccatgctgatgaacgacctcaacaagtggggcacgtacgag
atcccggaagaactgctggccaagattcgtcagatcttcggcaccggttgggccgatgag
gatcaggtacgcgagtccatcaagcactgttgggacgagaaccactacgtgatcgacccg
cacaccgcctgcggctactacctgcttgagcagatgccgcgcgacccgctgaccccgcgc
gtgctgctctccaccgccagcccctacaagttcccgcgcgtggtgaacgaggcattgggc
ttcgacgccaccggcaccgacttcgagtgcatggatgtgctggcccacgagaccggcacc
accgccccggccgccctgcgtggtcttgagaccgccgacgtgcggttcaaggacgtcgtg
gccatcgacggcatggaggactacgtggagaaggccgcccaggcgctgtga

DBGET integrated database retrieval system