KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0607Help
Entry
BLIF_0607         CDS       T01420                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BLIF_0607
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BLIF_0607
Enzymes [BR:blf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BLIF_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(768601..769803)
Genome map
AA seq 400 aa AA seqDB search
MATICALAVVLAGVAAYGWHVGWFAKSTSNGNTTTPQTSQTSALPRADVPSPKKNEPAAQ
AQRAVSAMTLEERVGQLVMVPLLAGSDPSSLASTIADEHIGSAILIGNWNTGADTVKTAT
AQLQGYAPAGNRLIIATDQEGGQVQHLTGTGFDTMPSAVEQGTMSADALRQSAGTWGSQL
AAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRDAQVGAAV
KHYPGLGAVSGNTDFTTEGILDTTTTLGGAEAGAFDQAITKTDPAMVMMSLATYQSIDPN
NPAVFSSTIIDGHIRNALKYTGVVISDSMSAEALSSYDVSQLGVKLVEAGGDMSCIGQTD
YVKPIVDGLNERAKSDPAFASKVTAAATRVMALKIKMGLA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacaatatgtgctttggcagtggtgttggccggcgtggcagcctacggatggcat
gtcggatggttcgccaaatccacatcaaacggcaacaccaccactccccagacctcccag
acaagtgcgttaccacgcgccgacgttccttccccgaagaagaacgaaccggccgcacaa
gcccaacgtgcggtatccgccatgacacttgaggaacgtgtgggacagttagtgatggtg
ccgttgcttgccggttccgatccctcctcgttggcttcaacaatcgccgatgagcacatt
ggctcggccattctcattggcaattggaataccggcgccgatacggtcaagaccgcgacc
gcgcaactccaaggatatgcgccggccggcaatcgtctcatcatcgccaccgatcaggag
ggtggtcaggtgcagcatctgactggtaccggtttcgacacaatgcccagtgccgttgag
cagggcacaatgtccgctgacgcattgcgtcaatcggcaggcacgtggggttcgcaatta
gctgctgctggcataaatgtcgatttggcaccggtgctcggcacggtggtgggcgatcgt
gcctcaaatgctccgattggcgcgctggatcgtgatttcggattggatgcggccggcaac
gccgaacatggcatcgccgttattgaaggtttgcgagacgctcaggtcggcgcggcggtc
aaacattatcctgggttgggcgcggtaagcggcaataccgacttcaccaccgaaggcatt
ctggatacgaccaccacgttgggcggggccgaggcaggtgcctttgaccaggcgatcacc
aagaccgatcctgcgatggtgatgatgtcgttggccacgtatcaatccatcgacccgaat
aatccggcggtgttttcttctacgattatcgacggtcatattcgcaacgccctgaagtac
acgggcgtggtgatttcggattcgatgtctgccgaagcgttaagcagctacgatgtaagc
caattgggagtaaagcttgtcgaggcgggcggcgacatgtcctgcatcggtcagacggat
tacgtaaagccaattgtggacggcctcaacgaacgggcgaagtccgatccggctttcgct
tcgaaagtgacggcggcggcgactcgcgtaatggcattgaaaatcaagatgggactggcc
tga

DBGET integrated database retrieval system