KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0659Help
Entry
BLIF_0659         CDS       T01420                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLIF_0659
  Lipid metabolism
   00600 Sphingolipid metabolism
    BLIF_0659
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BLIF_0659
Enzymes [BR:blf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BLIF_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(830920..833991)
Genome map
AA seq 1023 aa AA seqDB search
MTDVTHVDRASQAWLTDPTVFEVNRTPAHSSHKWYARDPQSGQWSDLKQSLDGEWRVEVV
QAADINLEEEPATAESFDDSSFERIQVPGHLQTAGLMNHKYVNVQYPWDGHENPLEPNIP
ENNHVALYRRKFTVSAPVANAKQAGGSVSIVFHGMATAIYVWVNGAFVGYGEDGFTPNEF
DITELLHDGENVVAVACYEYSSASWLEDQDFWRLHGLFRSVELAARPHVHIENTQIEADW
DPEAGTASLDAALTVLNAADAATVRATLKDADGNTVWQTTGDAEAQTAISSGPLQGIAPW
SAESPTLYELDVDVIDQAGDVIECTSQKVGFRRFRIEDGILTINGKRIVFKGADRHEFDA
ERGRAITEQDMIDDVVFCKRHNINSIRTSHYPNQERWYELCDEYGIYLIDEANLEAHGSW
SLPGDVLTEDTIVPGSKREWEGACVDRVNSMMRRDYNHPSVLIWSLGNESYVGDVFRAMY
KHVHDIDPNRPVHYEGVTHNRDYDDVTDIETRMYSHADEIEKYLKDDPKKPYLSCEYMHA
MGNSVGNMDEYTALERYPKYQGGFIWDFIDQAIYATQPDGTRSLRYGGDFGDRPSDYEFS
GDGLLFADRKPSPKAQEVKQLYSNVHIDVTKDSVSVKNDNLFTATGDYVFVLSVLADGKP
VWQSTRRFDVPAGETRTFDVAWPVAAYRADARELVLQVSQRLAKATDWAESGYELAFGQT
VVPADATATPDTKPADGTITVGRWNAGVRGAGREVLLSRTQGGMVSYTFAGNEFVLRRPA
ITTFRPLTDNDRGAGHGFERVQWLGAGRYARCVDNVLEQIDDSTLKGTYTYELATAQRTK
VTVSYTAHTDGRVNLHVEYPGEQGDLPTIPAFGIEWTLPVQYTNLRFFGTGPAETYLDRK
HAKLGVWSTNAFADHAPYLMPQETGNHEDVRWAEITDDHGHGMRVSRADGAAPFAVSLLP
YSSFMLEEAQHQDELPKPKHMFLRVLAAQMGVGGDDSWMSPVHPQYHIPADKPISLDVDL
ELI
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtcacacatgtcgatcgcgcatcgcaggcttggctgaccgacccgacggtg
ttcgaggtgaaccggactccggcccattccagccacaagtggtacgcccgcgacccccag
agcggacaatggtccgatctcaagcagagccttgacggcgagtggcgggtcgaggtcgtt
caggccgccgacatcaacctcgaagaggaacccgcgacggccgagtcgttcgacgactcc
tcgttcgagcgtatccaggttccgggccacctgcagacggccggtctgatgaaccacaag
tacgtgaacgtccagtatccgtgggacggccacgagaacccgttggaaccgaacatcccg
gagaacaatcacgtcgcgctctaccgcaggaagttcaccgtctccgcccccgtggcaaac
gccaagcaggccggcggatcggtgtcgatcgtgttccacggcatggccacggcgatctac
gtgtgggtcaacggcgcgttcgtcggctatggcgaggacggcttcacgcccaatgagttc
gacatcaccgaactgctgcacgacggggagaacgtcgtggccgtcgcctgctacgaatac
tccagcgcctcctggcttgaggatcaggacttctggcgtctgcacggcctgttccgctcc
gtcgaactcgccgcccgcccgcatgtgcacatcgagaacacgcagatcgaagccgattgg
gatcccgaggccggcaccgcctccctcgatgccgcgctgaccgtgctcaacgcggccgac
gcggccacggtccgcgcgaccctgaaggacgccgacggcaacacggtgtggcagacgacg
ggcgacgcggaggcgcagaccgcgatctccagcgggccgctgcagggcatcgccccttgg
agcgccgaaagcccgacgctgtacgagcttgacgtcgacgtcatcgaccaggcgggcgac
gtcatcgaatgcacgtcccagaaggtcggtttccgccgcttccgcatcgaggacggcatc
ctgaccatcaacggcaagcgcatcgtgttcaagggcgccgaccgccacgagttcgacgcc
gaacggggccgcgccatcaccgagcaggacatgatcgatgacgtggtcttctgcaagcgc
cacaacatcaactccatccgcacctcgcactacccgaaccaggaacgctggtacgaactg
tgcgacgagtacggcatctacctgatcgacgaagccaacctcgaagcccacggcagctgg
tccctgcccggagacgtcctcaccgaggacaccatcgtgccgggtagcaagcgcgaatgg
gaaggcgcctgcgtcgaccgcgtcaacagcatgatgcgtcgcgactacaaccacccgagc
gtgctgatctggtcactgggcaacgaatcctacgtgggcgacgtgttccgcgccatgtac
aagcacgtgcacgacatcgacccgaaccgtccggtgcactacgagggcgtgacccacaac
cgtgactacgatgacgtcaccgacatcgagacccgtatgtactcgcatgccgacgagatc
gagaagtacctgaaggacgacccgaagaagccgtacctctcctgcgaatacatgcacgcc
atgggcaactccgtgggcaacatggacgaatacacggcgctcgaacgctacccgaagtat
cagggcggcttcatctgggacttcatcgaccaggccatctacgccacccagcccgacggc
accaggagcctgcgctacggcggagacttcggcgaccgtccgtccgactacgagttctcc
ggcgacggcctgctgttcgccgaccgcaagccttcccccaaggcccaggaagtcaagcag
ctgtactcgaacgtccacatcgacgtgacgaaggactcggtgtccgtcaagaacgacaac
ctgttcaccgccaccggcgactacgtgttcgtcctgagcgttctcgccgacggcaagccg
gtctggcagtccacccggcgtttcgacgtgcccgccggcgagacccgcacgttcgatgtc
gcatggccggtggcggcgtaccgcgccgacgcccgcgaactggtgctgcaggtttcgcag
cgtctcgccaaggcgaccgattgggccgaaagcggctacgagctcgccttcggacagacc
gtggtgcccgcggacgccaccgcgacgcccgacacgaagccggccgatgggaccatcacc
gtgggccgttggaacgccggcgtgcgaggcgccggacgcgaggtcctgctgtcgcgcacc
cagggcggcatggtctcctataccttcgccggcaacgagttcgtgctgcgccgtcccgca
atcaccaccttccgtccgctgaccgacaacgatcgcggcgccggtcacggtttcgagcgc
gtccagtggctgggcgccggccgctacgcccgctgcgtggacaacgtgctcgagcagatc
gacgacagcacgctcaagggcacgtacacgtatgagctcgccaccgcgcagcgcaccaag
gtgaccgtctcctacacggcccacaccgatggccgcgtgaacctgcacgtcgaataccct
ggagagcagggtgacctgcccaccatcccggcgttcggcatcgaatggacgctgcctgtg
cagtacacgaacctgaggttcttcggcaccggcccggcggagacgtacctggaccgcaaa
cacgccaagctcggcgtgtggagcaccaacgctttcgcggatcatgcgccgtacctcatg
ccgcaggagacgggcaaccatgaggatgtgcgttgggccgagattaccgacgatcacggc
cacggcatgcgcgtcagccgcgccgatggtgccgcgccgttcgcggtaagcctgttgccg
tactccagcttcatgcttgaggaggctcagcaccaggacgagctgccgaagccgaagcac
atgttcctgcgcgtccttgccgcacagatgggcgttggcggcgatgattcctggatgtcg
ccggtgcacccccagtaccatatcccggcggacaagccgatcagcctcgatgtcgacctc
gagctgatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system