KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0659Help
Entry
BLIF_0659         CDS       T01420                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:blf00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:blf00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:blf00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(830920..833991)
Genome map
AA seq 1023 aa AA seqDB search
MTDVTHVDRASQAWLTDPTVFEVNRTPAHSSHKWYARDPQSGQWSDLKQSLDGEWRVEVV
QAADINLEEEPATAESFDDSSFERIQVPGHLQTAGLMNHKYVNVQYPWDGHENPLEPNIP
ENNHVALYRRKFTVSAPVANAKQAGGSVSIVFHGMATAIYVWVNGAFVGYGEDGFTPNEF
DITELLHDGENVVAVACYEYSSASWLEDQDFWRLHGLFRSVELAARPHVHIENTQIEADW
DPEAGTASLDAALTVLNAADAATVRATLKDADGNTVWQTTGDAEAQTAISSGPLQGIAPW
SAESPTLYELDVDVIDQAGDVIECTSQKVGFRRFRIEDGILTINGKRIVFKGADRHEFDA
ERGRAITEQDMIDDVVFCKRHNINSIRTSHYPNQERWYELCDEYGIYLIDEANLEAHGSW
SLPGDVLTEDTIVPGSKREWEGACVDRVNSMMRRDYNHPSVLIWSLGNESYVGDVFRAMY
KHVHDIDPNRPVHYEGVTHNRDYDDVTDIETRMYSHADEIEKYLKDDPKKPYLSCEYMHA
MGNSVGNMDEYTALERYPKYQGGFIWDFIDQAIYATQPDGTRSLRYGGDFGDRPSDYEFS
GDGLLFADRKPSPKAQEVKQLYSNVHIDVTKDSVSVKNDNLFTATGDYVFVLSVLADGKP
VWQSTRRFDVPAGETRTFDVAWPVAAYRADARELVLQVSQRLAKATDWAESGYELAFGQT
VVPADATATPDTKPADGTITVGRWNAGVRGAGREVLLSRTQGGMVSYTFAGNEFVLRRPA
ITTFRPLTDNDRGAGHGFERVQWLGAGRYARCVDNVLEQIDDSTLKGTYTYELATAQRTK
VTVSYTAHTDGRVNLHVEYPGEQGDLPTIPAFGIEWTLPVQYTNLRFFGTGPAETYLDRK
HAKLGVWSTNAFADHAPYLMPQETGNHEDVRWAEITDDHGHGMRVSRADGAAPFAVSLLP
YSSFMLEEAQHQDELPKPKHMFLRVLAAQMGVGGDDSWMSPVHPQYHIPADKPISLDVDL
ELI
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtcacacatgtcgatcgcgcatcgcaggcttggctgaccgacccgacggtg
ttcgaggtgaaccggactccggcccattccagccacaagtggtacgcccgcgacccccag
agcggacaatggtccgatctcaagcagagccttgacggcgagtggcgggtcgaggtcgtt
caggccgccgacatcaacctcgaagaggaacccgcgacggccgagtcgttcgacgactcc
tcgttcgagcgtatccaggttccgggccacctgcagacggccggtctgatgaaccacaag
tacgtgaacgtccagtatccgtgggacggccacgagaacccgttggaaccgaacatcccg
gagaacaatcacgtcgcgctctaccgcaggaagttcaccgtctccgcccccgtggcaaac
gccaagcaggccggcggatcggtgtcgatcgtgttccacggcatggccacggcgatctac
gtgtgggtcaacggcgcgttcgtcggctatggcgaggacggcttcacgcccaatgagttc
gacatcaccgaactgctgcacgacggggagaacgtcgtggccgtcgcctgctacgaatac
tccagcgcctcctggcttgaggatcaggacttctggcgtctgcacggcctgttccgctcc
gtcgaactcgccgcccgcccgcatgtgcacatcgagaacacgcagatcgaagccgattgg
gatcccgaggccggcaccgcctccctcgatgccgcgctgaccgtgctcaacgcggccgac
gcggccacggtccgcgcgaccctgaaggacgccgacggcaacacggtgtggcagacgacg
ggcgacgcggaggcgcagaccgcgatctccagcgggccgctgcagggcatcgccccttgg
agcgccgaaagcccgacgctgtacgagcttgacgtcgacgtcatcgaccaggcgggcgac
gtcatcgaatgcacgtcccagaaggtcggtttccgccgcttccgcatcgaggacggcatc
ctgaccatcaacggcaagcgcatcgtgttcaagggcgccgaccgccacgagttcgacgcc
gaacggggccgcgccatcaccgagcaggacatgatcgatgacgtggtcttctgcaagcgc
cacaacatcaactccatccgcacctcgcactacccgaaccaggaacgctggtacgaactg
tgcgacgagtacggcatctacctgatcgacgaagccaacctcgaagcccacggcagctgg
tccctgcccggagacgtcctcaccgaggacaccatcgtgccgggtagcaagcgcgaatgg
gaaggcgcctgcgtcgaccgcgtcaacagcatgatgcgtcgcgactacaaccacccgagc
gtgctgatctggtcactgggcaacgaatcctacgtgggcgacgtgttccgcgccatgtac
aagcacgtgcacgacatcgacccgaaccgtccggtgcactacgagggcgtgacccacaac
cgtgactacgatgacgtcaccgacatcgagacccgtatgtactcgcatgccgacgagatc
gagaagtacctgaaggacgacccgaagaagccgtacctctcctgcgaatacatgcacgcc
atgggcaactccgtgggcaacatggacgaatacacggcgctcgaacgctacccgaagtat
cagggcggcttcatctgggacttcatcgaccaggccatctacgccacccagcccgacggc
accaggagcctgcgctacggcggagacttcggcgaccgtccgtccgactacgagttctcc
ggcgacggcctgctgttcgccgaccgcaagccttcccccaaggcccaggaagtcaagcag
ctgtactcgaacgtccacatcgacgtgacgaaggactcggtgtccgtcaagaacgacaac
ctgttcaccgccaccggcgactacgtgttcgtcctgagcgttctcgccgacggcaagccg
gtctggcagtccacccggcgtttcgacgtgcccgccggcgagacccgcacgttcgatgtc
gcatggccggtggcggcgtaccgcgccgacgcccgcgaactggtgctgcaggtttcgcag
cgtctcgccaaggcgaccgattgggccgaaagcggctacgagctcgccttcggacagacc
gtggtgcccgcggacgccaccgcgacgcccgacacgaagccggccgatgggaccatcacc
gtgggccgttggaacgccggcgtgcgaggcgccggacgcgaggtcctgctgtcgcgcacc
cagggcggcatggtctcctataccttcgccggcaacgagttcgtgctgcgccgtcccgca
atcaccaccttccgtccgctgaccgacaacgatcgcggcgccggtcacggtttcgagcgc
gtccagtggctgggcgccggccgctacgcccgctgcgtggacaacgtgctcgagcagatc
gacgacagcacgctcaagggcacgtacacgtatgagctcgccaccgcgcagcgcaccaag
gtgaccgtctcctacacggcccacaccgatggccgcgtgaacctgcacgtcgaataccct
ggagagcagggtgacctgcccaccatcccggcgttcggcatcgaatggacgctgcctgtg
cagtacacgaacctgaggttcttcggcaccggcccggcggagacgtacctggaccgcaaa
cacgccaagctcggcgtgtggagcaccaacgctttcgcggatcatgcgccgtacctcatg
ccgcaggagacgggcaaccatgaggatgtgcgttgggccgagattaccgacgatcacggc
cacggcatgcgcgtcagccgcgccgatggtgccgcgccgttcgcggtaagcctgttgccg
tactccagcttcatgcttgaggaggctcagcaccaggacgagctgccgaagccgaagcac
atgttcctgcgcgtccttgccgcacagatgggcgttggcggcgatgattcctggatgtcg
ccggtgcacccccagtaccatatcccggcggacaagccgatcagcctcgatgtcgacctc
gagctgatctga

DBGET integrated database retrieval system