KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0666Help
Entry
BLIF_0666         CDS       T01420                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Brite
Enzymes [BR:blf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     BLIF_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(843924..844622)
Genome map
AA seq 232 aa AA seqDB search
MTNHVRSVFLIRHGRTSYNAAHKLQGQVDIPLDAVGEWQVKQTAAALKRLYVDRRQEINH
RFIVCSDLKRAHATAQAFADVLGGIEPVDDRRVRERSFGDWDGHAVAELAERYPEDFRSW
MESRGGELKYGAEPKEAVGKRGVEALEDWSTRAGDDTDLFVFSHGAWIAQTLQTLLGISA
IDPTFSTVVSLRNAHWVRLVPMDNPDGTVRWRLLDYNHGPAIADTDEWERER
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatcatgttcgttccgttttccttatccgtcatggacgcacctcctacaacgcc
gctcacaagctccaaggccaggtcgacattccgctggacgccgtgggtgaatggcaggtc
aagcagaccgccgcggccttgaaaaggctgtacgtcgatcgtcggcaggaaatcaaccac
cggttcattgtctgctccgatttgaagcgtgcgcacgccaccgcgcaagctttcgccgac
gtattgggtggaatcgagcccgtcgatgatcgtcgcgtccgtgaacgcagcttcggtgat
tgggatggccatgccgtggccgaactggccgaacgctaccccgaggacttccgttcctgg
atggagtctcggggcggcgagctgaagtatggtgccgagcccaaggaagctgtgggcaag
cgcggcgtagaggctcttgaggactggtccacgcgtgccggagacgacacggacctgttc
gtgttctcgcacggcgcatggattgcgcagacattgcagaccctgttgggcatttctgca
atcgatccgaccttttctacggtggtttcattgcgtaatgcgcactgggtgcgcttggtg
ccgatggacaatcccgatggcactgtgcgctggcgtctgctggactacaatcacggtccg
gccatcgccgacaccgacgagtgggaacgcgaacgctga

DBGET integrated database retrieval system