KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0668Help
Entry
BLIF_0668         CDS       T01420                                 

Definition
UDP-N-acetylglucosamine pyrophosphorylase
Orthology
K04042  
bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.3.1.157]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:blf00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(845172..846554)
Genome map
AA seq 460 aa AA seqDB search
MALSAAIVLAAGEGTRMRSNKPKVLHAFAGKTFLNRVMDSVAALNPDTLAVVVHFQAERV
AEAARSYDEQVTIVNQDDIPGTGRAVQCAMAQLTEAGKVDGPVLIAASDMPLLDSETLHR
LVEFHTASGNGATVLTTILDDPTGYGRIIRDREGNVLRIVEQKDANRSELAVQEVNTSVY
VFEASVLTEAIAGLKSNNAQGEFYLTDALETAKAAGKVGAFAAPDPLTVEGVNDRVQLAA
LSKTYNRRVCERWMRDGVTILDPETTWIEDDVQIGRDATILPGSFLQGHTVVGEDAIVGP
YTTLIDATVDEGAVVERSRVQESHIGARTNIGPWTYLRPGNEFGEDAKAGAFVEMKKAHI
GNGTKVPHLSYVGDAQLGDHTNIGGGTITANYDGVHKNRTTIGSGCHVGAGNLFVAPVEV
GDNVTTGAGSVVRHAVPSDTMVYSENTQHNVEGWKPAWER
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcattatccgcagccatcgtcctcgccgccggcgagggtacccgcatgcgttccaac
aagccgaaggtgctgcatgcttttgcaggcaagaccttcctgaacagggtcatggattcg
gtggccgccctgaatcccgacacgttggccgtggtcgtgcacttccaggccgagcgcgtc
gccgaagccgcccgctcctatgacgagcaggtcaccattgtgaaccaggacgacattccc
ggtaccggccgcgccgtgcagtgcgcaatggcgcagctcaccgaggctggcaaggtcgat
ggcccggtgctgatcgccgcctccgacatgccgctgctcgacagcgagacgctgcaccgt
ctggtcgaattccacaccgcctccggcaacggcgccactgtgctcaccaccatcctcgat
gacccgaccggctacggccgcatcatccgcgatcgcgaaggcaacgtgctgcgcatcgtt
gaacagaaagacgccaaccgcagcgaactcgccgtgcaggaagtgaacacctcagtctac
gtgttcgaggcttccgtgcttaccgaggcaatcgccggactgaagtcgaacaacgcgcag
ggtgagttctatctgaccgacgcgctggaaaccgccaaggccgctggcaaggtcggcgcg
ttcgccgctccggatccgctcaccgtcgaaggcgtgaacgaccgcgtgcagctggccgcg
ctgtccaagacctacaaccgccgcgtctgcgagcgctggatgcgcgacggcgtgaccatt
cttgacccggaaaccacctggatcgaggacgatgtccaaatcggccgcgacgccaccatc
ctgcccggctccttcctgcaaggccacacggtggtcggcgaggacgccatcgtcggcccg
tacaccaccctgatcgacgcaaccgtggacgaaggtgccgtggtcgagcgttcccgcgta
caggaatcgcacatcggcgcacgcacgaacatcggcccgtggacctacctgcgcccgggc
aacgagttcggcgaggatgccaaggccggcgcgttcgtcgaaatgaagaaggcgcacatc
ggcaacggcaccaaggtgccgcacctgagctacgtgggcgacgcccagcttggcgaccac
accaacatcggcggcggcaccattaccgccaactatgacggcgtgcacaagaaccgcacc
accatcggctccggctgccacgtgggtgccggcaacctgttcgtggccccggttgaagtg
ggcgacaacgtgaccaccggcgccggttccgtggtgcgccacgccgtgccgagcgacacg
atggtctactccgagaatacgcaacacaacgtcgagggctggaagcccgcctgggagcgc
tga

DBGET integrated database retrieval system