KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0939Help
Entry
BLIF_0939         CDS       T01420                                 

Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
blf00240  Pyrimidine metabolism
blf00250  Alanine, aspartate and glutamate metabolism
blf01100  Metabolic pathways
Module
blf_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BLIF_0939
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BLIF_0939
Enzymes [BR:blf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BLIF_0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: BAJ71082
UniProt: E8MTI8
Position
1126159..1127121
Genome map
AA seq 320 aa AA seqDB search
MVGKSVVTLDGLSTNQILDLLHKAEYIDSHRKEIAHTCDGRVLATLFYEPSTRTRLSFET
AMLRLGGKVIGFAGAQLASVTKGESIADTLKTVSNYVDVVAIRHPKEGAALVASRAASVP
VINAGDGGHMHPTQTLADLATLQSRFGRITDLTVGLCGDLTFGRTVHSLIETLCRFGNVR
FVLISPDELKTPQYVIDRINATDSCSYVEVRDLASVIGDLDVLYMTRVQKERFFNEDDYL
RLRDTYILDEEKLQLAKPSMAVLHPLPRVNEIAVDVDDDPRAAYFEQVKNGMLVRMALES
TVVGDELPGYEPLNPKEVQA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcaaaagcgtcgtaacgctggacggcctgtctacaaaccagattctcgacctg
ctgcataaggccgaatacatcgattcccaccgcaaagagattgcccatacctgcgatggg
cgagtgctggccacgctgttctacgagccctccacccgtacgcgcctgagctttgagacc
gcaatgctacgtctcggcggcaaggtcatcggattcgccggcgcgcagctggcctccgtg
accaagggcgaatccatcgccgacacgttgaagaccgtgtccaactacgtggacgtggtc
gccatccgtcacccgaaggagggtgccgcgctggtggcctcccgcgccgcatccgtgccg
gtaatcaacgccggcgacggcggccacatgcaccccacgcagacgctggccgacctggcc
acgctgcagtcgcgcttcggccgcatcaccgacctgaccgtgggactgtgcggcgatttg
accttcggccgcaccgtgcactccctgatcgagaccctgtgccgcttcggcaacgtgcgc
ttcgtgctcatcagcccggacgagctcaagaccccgcagtacgtgatcgaccgcatcaac
gccaccgacagctgctcctacgtggaagtgcgcgacctggcctccgtgatcggcgacctc
gacgtgctgtacatgacccgcgtacagaaggaacgcttcttcaacgaagacgactacctg
cgcctgcgcgacacctacattctcgacgaagagaagctgcagctcgccaagccgtccatg
gccgtgcttcacccgctgccgcgcgtcaacgaaatcgccgtggacgtggacgacgacccg
cgtgccgcctacttcgaacaggtcaagaacggcatgctcgtgcgcatggccctcgaaagc
accgtggtgggcgacgaactgcccggatacgaaccgctcaaccccaaggaggttcaggcc
tga

DBGET integrated database retrieval system