KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0992Help
Entry
BLIF_0992         CDS       T01420                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLIF_0992
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLIF_0992
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLIF_0992
Enzymes [BR:blf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLIF_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1168479..1170566
Genome map
AA seq 695 aa AA seqDB search
MSVLDELVAGALEDQRTRELTVSLEDVKKAALAAPAPIDATRWLKRADGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYEKGGASAISVLTEGHKFLGSLDDFDKVRAAVHIPVLRKDFI
VTDYQIFEARAHGADLVLLIVAALDDAQLKHLLDLAHELGMTVLVETHTREEIERARKAG
AKVIGINARNLKNLKVDVNKYNELAADLPDDVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADNHELAVERLVKAGAQVKASETTPLSEHQGPYWGQFGGRYVPEALITALDELER
VYNEAKADPEFHKEFMTLQQRYVGRPSPLTEAPRFSALVKEKTGLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAICACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPE
SGKHAIRFAPGTGQLGMFQGAKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKDIGR
VNYSWATDEEAMNAFRDLSQTEGIIPAIESSHAVAGAYKAAADLKAKGYDKAVMIVNISG
RGDKDMATAGKWFGYLTDDQAAALDVTGTHGNTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggacgaactggtggcgggagcgctggaggatcagcgcacccgtgagctc
accgtatcgcttgaggatgtgaagaaggccgcgctggcggccccggctccgattgacgcg
acacgatggcttaagcgcgccgacggcatccccgtgatcgccgagatcaagcgcgcgtct
ccgtccaagggccacctgtccgacatcccggacccggccgcgctggcccgcgagtacgag
aagggcggcgcaagcgccatctccgtgctcaccgaaggccacaaattcctcggcagcctt
gacgatttcgacaaggtccgcgccgccgtgcacattccagtgctgcgcaaggacttcatc
gtcaccgactaccagatcttcgaggcccgcgcccacggcgccgacctggtgctgctcatc
gtcgccgcattggacgacgcccagctcaagcacctgctcgacctggcgcacgagctcggc
atgaccgtgctggtggagacgcacacccgcgaagagatcgaacgcgcccgcaaggccggt
gccaaggtgatcggcatcaacgcgcgcaacctgaagaacctcaaggtggacgtgaacaaa
tacaacgaactcgcggccgatctgcccgatgacgtcatcaaggtggcggaatccggcgta
ttcggcgcggtcgaggtcgaagactacgcccgcgcgggagcggacgcggtactggtcggc
gagggcgtggccaccgccgacaatcatgaacttgcagtggaacgactagtaaaggcagga
gcacaagtgaaagcatccgaaacgaccccgctcagcgaacatcagggaccgtattggggc
cagttcggtggccgctatgtgcccgaggccctcatcaccgccctcgacgagcttgagcgc
gtgtacaacgaggccaaggccgaccccgaattccacaaggaattcatgacgctccagcag
cgttacgtggggcgcccgagcccgctgaccgaagccccgcgcttctccgcacttgtcaaa
gagaagaccggtctcgacgcccgtatcttcctcaagcgcgaggacttgaaccacaccggc
gcgcacaagatcaacaacgcgctcggccaggcactgctcgtcaagcgcatgggcaagacc
cgcgtgatcgccgagaccggcgccggccagcacggcgtggccaccgccaccgtgtgcgcc
atgctcggcctcaagtgccgcatctacatgggccagatcgacgcccgccgtcaggccctc
aacgtggcccgcatgcgtatgctcggcgccgaagtggtcgaggtgacccttggcgacaag
atcctgaaggacgccatcaacgaagccctgcgcgactgggtcaccaacgtcaaggacacg
cactacctgctcggcaccgtcgcgggcccgcacccgttcccggccatggtgcgcgacttc
cagaagatcatcggcgaggaagccaagcagcagctccaggactggtacggcatcgaccat
ccggacgcgatctgcgcctgcgtgggcggcggctccaacgccatcggcgtgatgaacgcc
ttcctggacgacgagcgcgtgaacctctacggctacgaagccggcggcaacggccccgaa
tccggcaagcacgccatccgcttcgcccccggcaccggccagctcggcatgttccagggc
gccaagagctacctgctggaaaccgacgaaggccagacgctcgacacctactcgatctcc
gcaggcctcgactacgcttccgtgggccccgagcacgcatggctcaaggacatcggccgc
gtgaactacagctgggccaccgacgaggaggccatgaacgccttccgcgacctgagccag
accgagggcatcatccccgccatcgaaagctcgcacgccgtggccggcgcgtacaaagcc
gccgccgatctgaaggccaagggctatgacaaggccgtgatgatcgtgaacatctccggc
cgaggcgacaaggacatggccaccgccggcaagtggttcggttatctgaccgacgaccag
gccgccgcgctcgatgtgaccggcacccacggcaatactgtcgcctga

DBGET integrated database retrieval system