KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_0993Help
Entry
BLIF_0993         CDS       T01420                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLIF_0993
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLIF_0993
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLIF_0993
Enzymes [BR:blf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLIF_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1170590..1171459
Genome map
AA seq 289 aa AA seqDB search
MTNEATTPSGQPLGISHKPSKSGAMFTKFKAENKPAFIGYLPYGFPNPDVSLDAFRTMVE
HGVDAVEIGLPYSDPVMDGPVIQAAASIALNNGETIKRVFEAVETVANAGGVPLIMSYWN
LVYHYGVERFARDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSSTERLE
TVARNARGFVYAAARMGVTGERATIDASPELLVERTRQAGAENVCVGIGVSTAEQGAKVG
SYADGVIVGSALVHTLLADDNKTARDPKEGLKLLAAKSEELAEGIHNAR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgaagcaaccacgccgtccggccagccgctgggcatcagccacaagcccagc
aagtcgggcgctatgttcaccaagttcaaggccgagaacaagcccgccttcatcggctac
ctgccctacggcttccctaacccggacgtctcgcttgacgccttcaggacgatggtcgag
cacggcgtcgacgccgtggaaatcggcctgccgtactccgacccggtcatggacggcccg
gtcatccaggctgccgcctccatcgccctgaacaacggcgagaccatcaagcgcgtgttc
gaggccgtcgaaaccgtggccaacgccggcggcgtgccgctcatcatgagctactggaac
ctcgtgtaccactacggcgtcgagcgcttcgcccgcgacttcgagaacgccggtggcgcc
ggtctcatcaccccggaccttatcccggacgaggcgggggagtggatcgaagcctccgac
cgccacggactcgaccgcatcttcctggtctccccggactcgtccaccgagcgcctcgaa
accgtggcccgcaacgcacgtggcttcgtgtacgcggccgcccgcatgggcgtcaccggc
gaacgcgccaccatcgacgcctcgcccgaactcctcgtggaacgtacccgtcaggccggt
gccgagaacgtgtgcgtgggcatcggcgtgtccaccgccgaacagggcgccaaggtcggc
tcctacgcggacggcgtcatcgtcggctccgcgctcgtgcacaccctgctcgcggacgac
aacaagaccgcacgcgacccgaaggaaggcttgaagctgctcgccgccaagagcgaggaa
ctggccgaaggcatccacaacgcccggtaa

DBGET integrated database retrieval system