KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1010Help
Entry
BLIF_1010         CDS       T01420                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLIF_1010
   00052 Galactose metabolism
    BLIF_1010
   00500 Starch and sucrose metabolism
    BLIF_1010
   00520 Amino sugar and nucleotide sugar metabolism
    BLIF_1010
Enzymes [BR:blf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BLIF_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1185462..1186991)
Genome map
AA seq 509 aa AA seqDB search
MTEINDKAQLDIAAADDTDAVTSDTPEETVNTPEVDETFELSAAKMREHGMSETAINQFH
HLYDVWRHEEASSWIREDDIEPLGHVPSFHDVYETINHDKAVDAFAKTAFLKLNGGLGTS
MGLDKAKSLLPVRRHKAKQMRFIDIIIGQVLTARTRLNVELPLTFMNSFHTSADTMKALK
HHRKFSQHDVPMEIIQHQEPKLVAATGEPVSYPANPELEWCPPGHGDLFSTIWESGLLDV
LEERGFKYLFISNSDNLGARPSRTLAQHFENTGAPFMAEVAIRTKADRKGGHIVRDKATG
RLILREMSQVHPDDKEAAQDITKHPYFNTNSIWVRIDALKDKLAECDGVLPLPVIRNKKT
VNPTDPDSEQVIQLETAMGAAIGLFNGSICVQVDRMRFLPVKTTNDLFIMRSDRFHLTDT
YEMEDGNYIFPNVELDPRYYKNIHDFDERFPYAVPSLAAANSVSIQGDWTFGRDVMMFAD
AKLEDKGEPSYVPNGEYVGPQGIEPDDWV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaaataaacgataaggcccaactggatatcgccgccgctgacgacaccgacgcc
gtcacctcggacacccccgaagaaaccgtaaacacccccgaagtggatgagactttcgag
ctttcggccgccaagatgcgcgagcacggcatgagcgaaaccgccatcaaccagttccac
catttgtatgacgtatggcgccatgaagaagcctccagctggattcgtgaggacgacatc
gagccgcttggccacgtgcccagcttccacgacgtctatgagaccatcaaccacgacaag
gccgtggacgccttcgccaagaccgcattcctcaagctcaatggcggtctgggcacctcc
atgggattagacaaggccaagtcgctgttgccggtgcgtaggcacaaggccaagcagatg
cgcttcatcgacatcatcatcggtcaggtgcttaccgctcgcacccgcctgaacgtcgaa
ctgccgctgacgttcatgaactccttccacacttcggcggacacgatgaaggcgctcaag
catcatcgcaagttcagccagcatgacgtgccgatggaaatcatccagcatcaggaaccc
aagctcgtggccgccaccggcgaacctgtgagctaccctgcgaacccggagctggaatgg
tgcccgcccggccacggcgacctgttctccaccatctgggagtctggtctgcttgacgta
ttggaagagcgcggcttcaagtatctgttcatctccaattccgacaatctcggtgcgcgc
ccctcgcgtacgttggcccagcacttcgaaaacacaggtgccccgtttatggctgaagtg
gccatccgcaccaaggccgatcgcaagggcggccatattgtacgagacaaggccactggt
cgcctaatactgcgtgaaatgagccaggtccatccggacgataaggaagcggcccaagac
atcaccaagcatccttacttcaacaccaactcaatctgggttcgcatcgacgctttgaaa
gacaagctcgccgaatgcgatggtgtgttgccgttgccggtgattcgtaacaaaaagacc
gtgaatcccacggacccggattccgaacaggtgattcagctggaaaccgccatgggcgcc
gcaatcggtctgttcaacggttctatctgcgtccaagtggatcgtatgcgcttccttccg
gtgaaaaccaccaatgatttgttcattatgcgttccgatcgattccacctgacggacacg
tatgagatggaagacggcaattacatcttcccgaacgtcgaacttgatccgcgatactac
aagaacatccacgatttcgacgaacggttcccctacgccgtgccatctttggccgcagcc
aactcggtttccattcagggcgactggacattcggacgtgacgtcatgatgttcgccgac
gccaaactggaagataaaggcgagccaagctatgtgccgaacggcgaatacgttggtccg
caaggcatcgaaccggacgattgggtgtga

DBGET integrated database retrieval system