KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1017Help
Entry
BLIF_1017         CDS       T01420                                 

Definition
succinyl-CoA synthase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:blf01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:blf00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:blf00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:blf00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1195638..1196840)
Genome map
AA seq 400 aa AA seqDB search
MDLYEYQARQLLEEQDIPTPDAIFAQNSHEVAEAADKIGYPCVIKAQVKIGHRGQAGGVK
IAHNRDEAILESESILPMTIHGHKVSGVLVAEAKNILHEYYVSISVDRTSRDFDVLATAN
GGTEVEEIAKEHPEAVKRLHIDALGDFDLAAATEMAQSIGFYHADVDQAAQILLKMWRCF
KDNDATLVEINPLAKIGDPDDESTKQLSALDAKISLDDNASFRHDGWARFVDPIVPDPFE
QRAREHGLHYVHLHGEVGVIGNGAGLVMSSLDAVSGAGEEQGTNIKPANFLDIGGGASAA
VMAESLEIVLSDPQVESVFINVYGGITSCVEVANGILEAVAKLGGSKPIVVRFDGNAAAE
GLHILASANNPNIHVSETMEGAAAKAAQLAGEATQSKEVR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggatctttacgaataccaggcgcgtcagctgctcgaggaacaggacattcccaccccg
gacgccatctttgcccagaactcccatgaagtcgctgaagcggcggacaaaatcggctat
ccctgcgtaatcaaggcgcaggtcaagatcggtcatcgtggtcaggccggcggcgtcaag
atcgcccataaccgcgacgaggcgattcttgaatccgagtccatcctgccgatgaccatc
cacgggcacaaggtttccggcgtgcttgtagccgaagccaagaacatcctgcacgaatac
tacgtgtccatctccgtggaccgcacctcgcgcgacttcgacgtgctggccaccgctaac
ggcggcaccgaagtcgaggaaatcgccaaggaacatccggaggccgtcaagcgcctgcac
atcgatgcgctcggtgacttcgacctggccgcggccaccgaaatggcacagagcatcggc
ttctaccacgcggacgtcgatcaggccgcacagattctgctcaagatgtggcgctgcttc
aaagacaacgacgccacgctcgtggaaatcaatccgctcgccaagatcggcgacccggat
gacgaatccaccaagcagctgagcgccttggacgccaagatctccttggatgacaacgcc
tccttccgccatgacggctgggcgcgtttcgtggatcccatcgttcccgaccccttcgaa
cagcgcgcccgcgaacacggcctgcactacgtgcacctgcacggcgaggtcggtgtgatc
ggcaacggtgcaggactcgtcatgagttccctggatgccgtctccggcgctggcgaggaa
cagggcaccaacatcaagcccgccaacttcctggacatcggcggcggcgcctccgcagcc
gtcatggccgaaagcctggagatcgtactgtccgaccctcaggtcgaatccgtgttcatc
aatgtctatggcggcatcacctcctgcgtggaagtcgccaacggcatcctcgaagcggtc
gccaagctcggcggttccaagccgatcgttgtgcgcttcgatggcaacgccgccgccgag
ggtctgcatatcctcgcctccgccaataacccgaatatccatgtgtccgaaaccatggaa
ggcgcggcagccaaggccgcgcagctcgccggtgaggcgacccagtccaaggaggttcgc
tga

DBGET integrated database retrieval system