KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1287Help
Entry
BLIF_1287         CDS       T01420                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BLIF_1287
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLIF_1287
Enzymes [BR:blf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BLIF_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1484561..1486114
Genome map
AA seq 517 aa AA seqDB search
MALTLASAADLLKEHHLLREIIQGDVWTDDPARIASADEPFAGITYDTRKVTPGTLLCCK
GQFKAEYLNGIDEAGLAAYVAETEYSAATATPGLIVNDARKAMSLLSAAFYGYPQNELTV
IGVTGTKGKTTTSYFTQALINAVSGGKAALFSSVDNCLDGHTYVESDLTTPESMDAFRMM
REAADNGMKYLVMEVSSQAYKVDRVYGLTFDVAAFLNISPDHISPIEHPTFEDYLYCKRQ
IIVNAKSLVLGADSLHADLLREDAEAAGIGVTTFALHDADNAGTSADVVAWPADPAHASF
HIADGDQALGDYHLSIDGDFNYLNAAAAIAIAHAVGVSLDDADALHAIESVRIAGRMEQF
RDPQSNTLAIVDYAHNYASVTALLDFVYERWGEENPRITLVTGSAGNKAYDRRKEIVEAA
ENRIANFIFTAEDTDTEPIIDICMEMQGYITNKDVVSTVISDRLTAITNAIYDARAHADR
FNILLIIGKGNERWIKDHRKHVPFDGDDHVVERMFGL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctttgactttggcttcggccgctgacctgctcaaggaacaccatctgctgcgtgaa
atcatccaaggggatgtctggaccgacgacccggcccgtatcgcttcggcggatgagccg
ttcgccggcatcacctacgacacccgcaaggtcacgccgggcaccctgctgtgctgcaag
ggccagttcaaggccgaatatctgaacggcatcgacgaagccggcctggccgcatacgtg
gccgaaaccgagtactcagccgcaaccgccacccccggcctgatcgtcaacgacgcacgt
aaggcgatgagcctgctgtccgccgcgttctacggatatccgcagaacgagctcacggtc
atcggcgtcaccggcaccaagggcaagacgaccacctcgtacttcacgcaggcgcttatc
aacgccgtctccggcggcaaggccgcattgttctcctcggtcgataattgccttgacggc
cacacctacgtcgaatccgatctgaccacacccgaatcgatggacgccttccgcatgatg
cgcgaggcggccgataacggtatgaagtatctggtgatggaggtctcctcccaggcgtac
aaggtggaccgcgtctatggcctgactttcgatgtggccgcgttcctcaacatctccccc
gaccacatcagcccgatcgaacaccccacgttcgaggattacctgtattgcaagcgccag
atcatcgtcaacgcgaagtcgctggtactcggcgcggacagtctgcacgccgatctgttg
cgggaggacgcggaggcagccggcatcggcgtgaccaccttcgccctgcatgacgcggat
aatgccggcaccagtgcggacgtcgtcgcctggcccgccgacccggcgcacgcctccttc
cacatcgccgacggagatcaggcccttggcgactaccatctgtccatcgatggcgacttc
aactacctcaatgcggcggcagccatcgccatcgcccatgcggttggcgtatcgctcgat
gacgccgacgcactgcacgccatcgaatccgtacgtatcgccggccgtatggaacagttc
cgcgacccgcagtcaaacacgctcgccatcgtcgattatgcgcacaactacgcatccgtc
accgcgctgcttgacttcgtctacgagcgttggggcgaggaaaacccgcgtatcacgctg
gtgaccggatcggccggcaacaaggcctacgatcgtcgtaaggaaatcgtcgaggctgcc
gagaaccgtatcgcgaacttcattttcaccgccgaagatacggacaccgagccgatcatc
gacatctgcatggaaatgcaaggctacatcacgaacaaggatgtggtctccacggtgatt
tccgaccgtctgacggccatcaccaacgccatttacgatgcccgtgcgcacgccgaccga
ttcaacatcctgctgatcatcggcaagggcaacgagcgttggatcaaggaccatcgcaag
catgtgccgttcgacggcgacgatcacgtcgtcgaacgcatgtttggcttgtga

DBGET integrated database retrieval system