KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1546Help
Entry
BLIF_1546         CDS       T01420                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BLIF_1546
Enzymes [BR:blf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BLIF_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1806458..1808338
Genome map
AA seq 626 aa AA seqDB search
MNIRDIARIAGVSISTVSKIVNGKDSSISEETRKKVLTIVKEYHYKPYASASQRTRSYTI
GVLLRSPISFDSTLDGIIQAAQNAGYATDAYNSYSDPERELKNIAAICGRNVDGVIWEPA
TPDSLAYASQFPESTPLLTIGPNGGDQSLLLPYKEAAYKLTSELIERGHQHIACLMTKGR
RTQDFLEGFRSCLFDHQLPYSDDLVYYDLNDSLPGKIGSRDITGFVSSHYRRALEFTQMI
SPLHYRLPEDASLVSIKNDTAEALAYPGNTEISTYTIRNSDFGAYLCEKLIAQIEHDKEQ
HPSFVQDFHLDNTSTIAAPPTSAIKHVLVVGSINIDHYLSVPRLPHIGGTVSTKSAARYP
GGKGVNQAIGAAKLGHRVTLIGNVGVDNGSDYIFKAMEQHGVNTAGVRRCAGEDTGSSFI
FLAPNGESVIAILSGANASLTPDDITSNERLFDNAGYCLIQTEIPLESAKVTAITARRHH
AKTIIKPSSCDYLPDSIVANADILVPNEHELAIIETEGKTMEDKAAHLLERGAGCVIVTQ
GEHGCYLRGQNVECHYPAADFTPVDSTGAGDAFISALASYLMYGYTVRQAVEIATYAAGY
SITRKGVIPSLIDRLSLDAYVHHSEQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcagggacatcgcacgcatcgcgggcgtctccatctcgacggtctccaaaatc
gtcaacggcaaggattccagcatcagcgaggaaacccgcaagaaggtcctgacgatcgtc
aaggaatatcattacaagccatatgcctccgcctcacagcgcacgcgtagctacaccatc
ggagtgctgctgcgctcccccatctccttcgatagcacgctggacggcatcatccaggcc
gcccagaacgccggatacgcaaccgatgcctacaacagctattccgatccggaacgcgag
ctcaaaaacatcgcagcgatatgcggccgcaacgtcgacggcgtcatctgggaaccggcc
actccggacagcctcgcctatgcctcgcaattccccgaaagcaccccactgctgaccata
ggacccaacggcggcgaccagtcactgctactgccttataaagaagcggcctacaaactg
accagcgagctcatcgaacgggggcaccaacacatcgcctgcctaatgaccaagggacgc
cgcacgcaggattttctcgaaggctttcgctcctgcctgttcgatcatcagctgccttat
agcgacgatctggtctactacgacctcaacgactcgctgcccggcaaaatcggaagccgg
gacatcaccggatttgtctcctcgcattaccggcgagcactcgagttcacgcagatgatc
agccccctgcattaccggcttccagaggatgcttcacttgtctccatcaaaaacgacacc
gccgaagcgctggcctatcccggcaacacggaaatatctacctacaccatccgcaactcc
gacttcggcgcctacctctgcgagaagctcattgcgcagatagagcacgacaaagagcag
catccctcgttcgtacaggattttcatctcgacaacaccagcaccatcgcagccccgccc
acttccgccatcaaacatgtgttggtcgtcggcagcatcaatattgaccactatctgtca
gtgccgcggctacctcatatcgggggtacggtatccaccaaatcggcggcgcgatacccc
gggggcaaaggggtcaatcaggcgatcggcgcagccaagctcgggcaccgcgttaccctt
atcggcaatgtcggcgtcgacaatgggtccgattacatcttcaaggcgatggaacagcat
ggggtcaatacggccggtgtgcgacgctgcgccggagaggacaccggctcatcgttcata
ttcctcgcccccaacggcgaatcggtcatcgcgattctctccggagccaacgcgtcgctc
accccggatgacatcacctccaacgaacgcctgttcgacaatgccggatactgcctgata
cagaccgaaataccgttggaatcagccaaagtcaccgcgatcaccgcccgacggcaccat
gccaaaaccattatcaagccctcgtcatgcgactatctgcccgactccatcgtcgccaat
gccgacattctcgtgccgaacgagcacgaactggcgatcatcgaaactgagggaaaaaca
atggaggataaggccgcgcatcttctcgaacgcggcgcgggctgcgtcatcgtcacccaa
ggagaacacggctgctacctgcgcggccagaatgtcgagtgccactatccggccgctgac
ttcacccccgtagacagcaccggagccggcgacgcgttcatcagcgcgctcgcctcgtat
ctgatgtacggatacaccgtgcggcaggcggtcgaaatcgccacctatgccgccgggtac
tcaatcacccgcaaaggcgtcataccctcgcttatcgaccggctctcgctggacgcctac
gtccatcacagcgaacagtag

DBGET integrated database retrieval system