KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1641Help
Entry
BLIF_1641         CDS       T01420                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
blf00010  Glycolysis / Gluconeogenesis
blf00052  Galactose metabolism
blf00500  Starch and sucrose metabolism
blf00520  Amino sugar and nucleotide sugar metabolism
blf00521  Streptomycin biosynthesis
blf01100  Metabolic pathways
blf01110  Biosynthesis of secondary metabolites
blf01120  Microbial metabolism in diverse environments
blf01130  Biosynthesis of antibiotics
blf01200  Carbon metabolism
Module
blf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIF_1641
   00052 Galactose metabolism
    BLIF_1641
   00500 Starch and sucrose metabolism
    BLIF_1641
   00520 Amino sugar and nucleotide sugar metabolism
    BLIF_1641
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BLIF_1641
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BLIF_1641
Enzymes [BR:blf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BLIF_1641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase Glucokinase FtsA BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: BAJ71778
UniProt: E8MVI4
Position
complement(1915134..1916084)
Genome map
AA seq 316 aa AA seqDB search
MTTLAIDIGGTKIAAAVCDENDSIIQRWRVPTPMDADAINQHIAEVYREAVAAGHTDIEA
IGISAAGNVSADRKTLTFSANIPAWINYDLSEHVGALIDHAVPVVVENDANCAGWGEYVH
GAGQGSSNMVALTVGTGLGGAIVINGQLYRGSFGMAAELGHLPMVPDGDHCGCGLRGCAE
RYTSGTSLENFAKSAVRRRPQDAKRLMELCGGDISKLEGPMVSQAAQEGDVLGLYAFGKI
GEWLGRTMAAVSAVLDPDLFVIGGGVVAVGDILLEPARYNYQRFLEGSAYRGHAKIVAAT
AGQDAGLIGAANLALR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcgccattgatatcggaggaactaagatcgccgccgccgtctgcgatgaa
aacgatagcatcatccagcgctggcgcgtccccacgccgatggatgccgacgccatcaac
cagcacatcgccgaggtgtaccgcgaggctgtggccgccggacacaccgatatcgaggcc
atcggcatctccgccgccggcaacgtgagcgccgaccgcaagacgctcaccttctccgcc
aacatcccggcctggatcaactacgacctgtccgagcacgtcggcgcgctgatcgaccat
gccgtgccggtcgttgtcgagaacgacgccaactgcgccggctggggcgaatacgtgcac
ggtgccggccagggcagctccaacatggtcgccctgaccgtgggcaccggcctcggcggc
gccatcgtgatcaacggtcagctgtaccgcggctccttcggcatggccgccgaactcggc
cacctgccgatggtcccggacggcgaccactgcggctgcggcctgcgcggctgcgccgag
cgctacacctcgggcacttcgctggagaacttcgccaagtccgccgtgcgccgtcgtccg
caggatgccaagcgtctcatggagctgtgtggcggcgacatctccaagctggaaggcccg
atggtctcccaggccgcccaggaaggcgacgtgctcggcctgtacgcattcggcaagatc
ggcgaatggcttggccgcacgatggccgcagtctccgccgtgctcgatccggacctgttt
gtgatcggcggcggtgtggtggccgtcggcgacattctgctggagccggcccgctacaac
taccagcgtttcctggaaggcagcgcctaccgcggccatgccaagatcgtcgccgccacc
gccggccaagacgccggcctcatcggtgccgccaacctggctctgcgctga

DBGET integrated database retrieval system