KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1677Help
Entry
BLIF_1677         CDS       T01420                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
blf00010  Glycolysis / Gluconeogenesis
blf00260  Glycine, serine and threonine metabolism
blf00680  Methane metabolism
blf01100  Metabolic pathways
blf01110  Biosynthesis of secondary metabolites
blf01120  Microbial metabolism in diverse environments
blf01130  Biosynthesis of antibiotics
blf01200  Carbon metabolism
blf01230  Biosynthesis of amino acids
Module
blf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIF_1677
  Energy metabolism
   00680 Methane metabolism
    BLIF_1677
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLIF_1677
Enzymes [BR:blf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLIF_1677
Membrane trafficking [BR:blf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BLIF_1677
Exosome [BR:blf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLIF_1677
  Exosomal proteins of melanoma cells
   BLIF_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAJ71814
UniProt: E8MVM0
Position
complement(1955640..1956380)
Genome map
AA seq 246 aa AA seqDB search
MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVLPDIVFTSLLR
RAINTANIALDAADRLWIPVQRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWRRSYAT
PPPEIDPNDQYAQNNDPRYAGDPVPEAECLANVVERVKPYFESAIEPELKAGKTVLIAAH
GNSLRAIVKMLDNLSEEEIAKVNIPTAIPLLYELDENFKPIKPRGEYLDPEAAAAGAAAV
AAQGQK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaactagtactgctccgtcatggacagagcgcatggaataaaactaaccag
ttcaccggctgggtcgacgtaccgctgaccgagcagggtgaagccgaagccaagcgtggc
ggcgagctgctcaaggagaagaacgtccttccggacatcgtgttcacctccctgctgcgt
cgcgccatcaacaccgccaacatcgctctggatgccgcagatcgtctgtggattccggtt
cagcgtgactggcgtctcaacgagcgtcactacggcgctctgcagggcaagaacaagacc
gagatccgcgaagagtacggcgacgagaagttcatgctgtggcgccgttcttacgccacc
ccgccgcccgagatcgacccgaacgaccagtacgcccagaacaacgacccgcgctacgcc
ggcgatccggttccggaagccgagtgcctggccaacgttgttgagcgtgtgaagccgtac
ttcgagtccgctatcgagccggagctcaaggccggcaagaccgtgctgattgctgcccac
ggcaactccctccgcgccatcgtcaagatgctggacaacctgtctgaggaagagatcgcc
aaggtcaacatcccgaccgccatcccgctgctctacgagctggacgagaacttcaagccg
atcaagccgcgtggcgagtacctggacccggaggctgctgctgccggtgccgccgctgtc
gccgctcagggccagaagtga

DBGET integrated database retrieval system