KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1753Help
Entry
BLIF_1753         CDS       T01420                                 

Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BLIF_1753
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIF_1753
   00620 Pyruvate metabolism
    BLIF_1753
   00650 Butanoate metabolism
    BLIF_1753
  Lipid metabolism
   00071 Fatty acid degradation
    BLIF_1753
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLIF_1753
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLIF_1753
   00626 Naphthalene degradation
    BLIF_1753
Enzymes [BR:blf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLIF_1753
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BLIF_1753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2034633..2037362)
Genome map
AA seq 909 aa AA seqDB search
MAEAKKKVEATKPTPEEKQAAAEAEVDALVARAKKALVEFENLDQKQVDRIVAKASIAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTNYLAGQKTVGIIREDDVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQKCSVEAAKIVRDAAIEAGAP
ENCIQWIEHPSIQATGALMKHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVDT
DVDIVRAANDLVLSKHFDYGMICATEQAIIAHKDVYDQLIKELKVRKAYFVNAEEKAKLE
QYMFGCTAGSGVKPVLNSAVPGKSPQFIAKAAGFEIPSDATILAAECKEVSDDEPLTHEK
LAPVQAVLKADNKEQAFEMCEKMLKLGAGHTAAIHTNNQELVREYGVRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLVNIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKIIDQLRARSNRVTFRIIDYVEPEPSV
ETVEKGAEMMREEFEPDTIIAVGGGSPMDASKIMWLLYEHPEIAFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLAKTNA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGQIPEEP
TSWPKYNKYIAPERYQDIARNLGIDTGKTPAEAVENLAKAVEDYRDNKLGMNKSFQDCGV
DEDYFWSVLDQIGMRAYEDQCTPANPRIPLINDMKDIAVGAYYGVSQAEGHKLRIEREGE
AATEEASER
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaagcaaagaagaaggtcgaagctaccaagccgactccagaagagaagcaggcc
gcagctgaggccgaagttgacgcgctggttgcccgcgccaagaaggctctcgtcgaattc
gagaacctcgaccagaagcaagttgatcgtatcgtcgccaaggcctccatcgccgctctg
aacaagcacctcgttctcgccaagatggctgtcgacgagaccggccgtggtctcgtggaa
gacaaggccaccaagaacatcttcgcctgcgagcacgtcaccaactacttggccggccag
aagaccgtcggcatcatccgtgaagacgacgtgatgggcatcgatgaggtcgccgagccc
gtcggcgtggtcgccggtgtcaccccggttaccaacccgacctccaccgccatcttcaag
tccctcatcgccctgaagacccgttgcccgatcgtcttcggcttccaccccggcgcgcag
aagtgctccgtcgaggccgccaagattgtgcgcgacgccgccatcgaagccggtgctccc
gagaactgtatccagtggatcgagcacccgtccatccaggccacaggcgccctgatgaag
catccgggcgtggccacgatcctcgccaccggtggtccgggcatggtcaaggccgcttac
tcctccggcaagcccgccctcggcgtgggtgccggcaacgccccggcctacgttgacacc
gatgttgacatcgtgcgcgccgccaacgatctggtgctctccaagcacttcgattacggc
atgatctgcgccaccgagcaggccatcatcgcccacaaggacgtctacgaccagctcatc
aaggagctcaaggtccgtaaggcctacttcgtcaacgccgaagagaaggccaagctggaa
cagtacatgttcggctgcactgccggttccggcgtcaagcccgtgctgaactccgcggtg
ccaggcaagtccccgcagttcatcgccaaggctgctggcttcgagattccgtccgacgcc
accattctggccgccgagtgcaaggaagtctccgacgacgagcctctgacccacgagaag
ctcgctccggtgcaggccgtgctcaaggccgacaacaaggagcaggccttcgagatgtgc
gagaagatgctcaagctgggtgccggccacaccgccgccatccacaccaacaaccaggag
ctcgtgcgtgagtacggcgtccgtatgcacgcctgccgcatcatctggaaccagccttcc
tcccttggcggcatcggcgacatctacaacgccatcgccccgtcgctgaccctgggctgc
ggctcctacggcggcaactcggtgtccggcaacgtgcaggccgtgaatctcgttaacatc
aagcgcattgctcggaggaacaacaacatgcagtggttcaagatcccggccaagacctac
ttcgagccgaacgccatcaagtacctgcgcgacatgtacggcatcgagaaggccgtcatc
gtgtgcgataaggtcatggagcagctcggcattgtcgacaagatcatcgaccagctgcgc
gcccgctccaaccgtgtgaccttccgcatcatcgactacgtcgagccggagccctccgtc
gagaccgtcgaaaagggcgctgagatgatgcgcgaggagttcgagccggacacgatcatc
gcggttggcggcggctccccgatggatgcctccaagattatgtggctgctctacgagcac
ccggaaatcgccttctccgacgtgcgcgagaagttcttcgatatccgtaagcgcgccttc
aagatcccgccgctgggcaagaaggccaagctggtgtgcatcccgacctcctccggcacc
ggttccgaggtcaccccgttcgccgtgatcaccgatcacaagaccggctacaagtacccg
atcaccgactacgcgctgaccccgtccgtggccatcgtggacccggtgctggctcgcacc
cagccgcgcaagctggcctccgacgccggcttcgacgccctgacccactcgatggaagcc
tacgtgtccgtgtacgcgaacgacttcaccgacggcatggccctgcacgcggccaagctc
atctgggacaacctggctgagtccgtcaatggcgagcccggcctggccaagaccaacgct
caggagaagatgcacaacgccgccaccatggccggcatggcattcggctccgcgttcctc
ggcatgtgccacggcatggcccacaccatcggtgccctgtgccacatcgcccacggccgt
accaactccatcctgctgccgtacgtgattcgctacaacggccagattcctgaggagccc
acctcttggccgaagtacaacaagtacatcgccccggagcgctaccaggacatcgcccgc
aacctcggcatcgacaccggcaagaccccggccgaagccgtggagaacctggcgaaggcc
gtcgaggactaccgtgacaacaagctcggcatgaacaagagcttccaggattgcggtgtg
gacgaggactacttctggtccgtgctcgatcagatcggcatgcgcgcctacgaggaccag
tgtaccccggccaacccgcgcatcccgctgatcaacgacatgaaggacatcgccgtcggt
gcttactacggtgtctcccaggcggaaggccacaagctgcgcatcgagcgcgagggtgag
gccgccactgaggaagcctccgagcgttga

DBGET integrated database retrieval system