KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1758Help
Entry
BLIF_1758         CDS       T01420                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BLIF_1758
Enzymes [BR:blf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BLIF_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2043059..2045224)
Genome map
AA seq 721 aa AA seqDB search
MSEITESEERLARPLIRLAKLVGVGTSYLGMSHDYHEIDDDVLIEVLAALGIDASSESAQ
LIAIRRILNERYARLVAPTVLHIAGSEDRVLVNTGILDVPSASITLENGEPYQGTIEVGP
GDGSQAYDLDGTFISNAAVVIPADLPIGYHTLHVKVADRVQDATLISAPDRVDLLDPMKG
GSLWGWMAQLYSIRSSNSWGVGDYEDLKTMLVDAKQKTGADFVLINPVHAAEPVSPLTPS
PYLPVSRRLINFTYIRPEAIAEYATLSEGDKNAVDGLHADTEPLNGDSQLIDRDAMWRSK
MHALWIIFKAGRTAERQSVFDQFKADCGSDLEAYATWCLCYDKWGAPNGEESNWERKFNR
NSPEIANLRKQYPDTLDFYRWLEWIAAEQLSSAQQAAKDAGMHIGIMSDMAVGVHPSGAD
VWWNPERFAKGATVGAPPDMFNQQGQNWSQPPLSPINLETTGYEAYRNMVHGMFARAGAV
RIDHILGLFRLWWIPENRSAMDGAYVYYDSDIMLGVLAIEASRAGGVVVGEDLGVVPDHV
ADSLSSHGILGCAVEWFEQCDGVFRAPSQWRPYALASVNTHDLPPAAGYLEYEHVKIRER
LGLLTGPAEEFEASAKAEQDAMLAMLVEQGYLDADFAEHREDHEADIVDALYHALKGSPC
KLLAASITDAVGEKRAQNQPGTNNEYPNWRIPLADAKGNVVPLETLFDTPGAQRFAQIFN
S
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagattaccgagagtgaagagcgtctggcccgtccgttgattcgactggccaag
ttggtcggtgtcggcacgagttatttgggcatgagccatgactaccacgagatagacgat
gacgtcctgatcgaggtgctggcagcgctgggcatcgacgcctccagcgagagcgcccaa
ctcatcgccatccgacgcattctgaacgagcgttacgcccgattggtggcacccaccgtg
ctgcatatcgccggtagcgaggaccgggtgctggtgaacaccggtattctggacgtgcct
tcggcgagcatcacgctggagaatggcgagccatatcaaggcaccattgaagttggtcct
ggagatggatcccaggcctacgacttggatggtacgttcatttcgaatgcggctgtggtc
attcccgccgatctgccgattggttaccatacgctgcacgtcaaggtcgccgaccgtgtg
caagacgccactttgatcagtgcacctgatcgcgtcgatctgcttgacccgatgaagggc
ggcagtctgtggggctggatggcccagctgtactcgattcgctcctccaactcctggggc
gtgggcgattacgaggatctgaagaccatgctggtggacgccaagcagaagaccggtgcc
gacttcgtgctcattaatccggtgcatgccgccgagccggtgtccccgctcaccccgtcg
ccgtatctgccggtaagccgtcgcctgatcaacttcacgtacatccgtcctgaggcgatc
gccgaatatgccacgctcagcgagggcgacaagaatgccgtcgacggactgcatgccgac
accgaaccgctgaacggtgattcccagctcatcgaccgtgacgccatgtggcgcagcaag
atgcacgccctgtggattatctttaaggccggccgtaccgccgaacgccaaagcgtattc
gaccaattcaaggcggactgtggttccgacttggaggcgtatgccacgtggtgcctgtgc
tacgacaagtggggagcacccaacggcgaggagagcaactgggagcgcaagttcaatcgc
aactccccggaaatcgccaatctgcgcaagcagtacccggacactttggacttctaccgc
tggctggaatggattgccgccgagcagctgtcctccgcccaacaggcagccaaggacgcc
ggcatgcatatcggcatcatgtccgatatggccgtcggcgtgcacccctccggcgctgac
gtgtggtggaatcccgagcgcttcgccaagggagccacggtcggcgcaccgccggacatg
ttcaaccagcaaggccagaactggagccagccgccgctgagcccgatcaatctggagacc
accggctacgaggcctaccgcaatatggtgcatggcatgttcgcccgtgccggtgcggtg
cgcatcgatcacatccttggtctgttccgcctgtggtggattcccgagaaccgttcggct
atggatggcgcttacgtgtactacgactcagacatcatgctgggcgttctggccatcgag
gcctctcgcgccggcggcgtggtcgtaggtgaggacctcggcgtggtgccggaccatgtg
gccgattccctgtcgagccacggtattctcggttgcgccgttgaatggttcgagcagtgc
gacggcgtgttccgcgccccctcccagtggcgtccgtatgcattggcctccgtgaatacg
catgatttgccgccggccgccggttacctggaatacgagcacgtcaagattcgtgagcgt
ctgggcttgctgaccggcccggccgaggaattcgaagcctccgccaaggccgagcaggat
gcgatgctggccatgctggtcgagcagggttatcttgatgccgactttgccgaacatcgt
gaggatcacgaggcggatatcgtcgacgcgctgtaccacgcactgaagggttcgccgtgc
aagctgctcgccgcctcgatcaccgacgcggtgggggagaagcgtgcgcagaaccagccg
ggcaccaacaacgaatacccgaactggcgcatcccactggccgacgccaagggcaacgtg
gtaccgctcgaaaccctcttcgacacccccggtgcccaacgcttcgcccaaatcttcaat
tcctga

DBGET integrated database retrieval system