KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1941Help
Entry
BLIF_1941         CDS       T01420                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
blf00052  Galactose metabolism
blf00561  Glycerolipid metabolism
blf00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLIF_1941
  Lipid metabolism
   00561 Glycerolipid metabolism
    BLIF_1941
   00600 Sphingolipid metabolism
    BLIF_1941
Enzymes [BR:blf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BLIF_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 Glyco_hydro_31 GHL10 Glyco_hydro_97
Motif
Other DBs
NCBI-ProteinID: BAJ72075
UniProt: E8MWD1
Position
complement(2315593..2317899)
Genome map
AA seq 768 aa AA seqDB search
MAENTSTFTGAAADGTALTAVYLTQPAANVAIGLVFAGSDLPHIVHWGRPLAKPDTLLAA
YDALKPQRVSGALDDTAWPSILPTQAESWIGEQRVVLRRAGVELFPKFTVTNIEAGGVLE
ATLDAVSGESYTDVAGHARATGPVRVPGVIVTARDEEQGVEVEWHLELLPGGLVRQKATV
TNLFGADAGAPLEIGKIELGFPLPESAGEILTTTGHHLRERSPQRQPLTVGRFEKPQLAG
RPDFDASLLLTAGVPGFSFEHGDAYSVHVGWSGNSVLSAERLPYTTGVIGGGELLFGGEV
TLAGPGEGQNSYDTPWLFGSYGDGLNEIAARFHSYVRSLHPRLFSHGRPVILNTWEAVYF
DHNFDTLKALADRAADSGVERFVVDDGWFGSRRDDTSGLGDWQIAQDVWPDGPKSLKALA
DYVHAKGMEFGLWFEPEMVNPDSDVARNHPDWILSPTTGRLPLQGRTQQVLDLTNPDAFD
YIYGCMDQLVGELGIDYIKWDHNKLVTEPGSRRSGRPAVHAQTLAVYNIFKGLKTAHPGL
EIESCSSGGGRVDLGILEHADRIWVSDCVDPVERADIQRYTSLLVPPAMMGEHVGASPAH
STQRATSQELRMAMAFFGHMGIEWNLLKEPDEALAKLAVWVAEFKKHRDWFAIDTCVHAD
SNDPAVRLDGMVMPNRDAAIYRFTQLTTSQTYPAAPVHLPGLDPERTYRVSPLDPSLDLT
GLTNGQSTLGWWNEEGVVLTGEALQRYGIRPPSLHPQQAVLLKAVALS
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacacctccactttcaccggcgccgccgctgacggcaccgcactcaccgcc
gtctacctgacccagcccgccgccaatgtggcgatcggtctggtgtttgccggcagcgac
ctgccgcacatcgtccactggggccgcccgctggccaagcccgacaccctgctggccgcc
tatgacgccctgaagccgcagcgcgtgtccggcgcgctcgacgacaccgcctggccgtcc
atcctgcccacccaggccgaaagctggatcggcgagcagcgcgtggtgctgcgccgcgcc
ggcgtcgagctcttccccaagttcaccgtgaccaatatcgaggccggcggcgtgctggaa
gccaccctcgatgccgtgtccggcgaaagctacaccgatgtggccggccatgcccgtgcc
accggtccggtccgcgtgcccggcgtcatagtcaccgcgcgcgatgaggagcagggcgtg
gaagtcgaatggcacctcgaactgctccccggcggcctggtccgtcagaaggccaccgta
accaacctgttcggtgcagacgccggagccccgctcgagatcggcaagatcgagctcggc
ttcccgctgcccgaatccgccggcgaaatcctcaccaccaccggtcaccatctacgtgaa
cgcagtccgcagcgccagccgctgaccgtcggccgtttcgaaaagccgcagctcgccggc
cgccctgacttcgacgcatccctgctcctgaccgccggcgtgcccggtttcagcttcgag
catggcgacgcctattcggtgcacgtgggctggagcggcaactccgtgctgtccgccgaa
cgtctgccctacacaaccggcgtgatcggcggcggcgaactcctgttcggcggcgaagtg
acgctcgccggccccggcgaaggccagaactcctacgacaccccgtggctgttcggctcc
tatggcgatggtctcaacgagatcgccgcccgattccactcctacgtgcgctccctgcac
ccgcgcctgttctcgcacggccgtccggtgatcctcaacacatgggaagccgtgtacttc
gaccacaacttcgatacgctgaaggcgctcgccgacagggccgccgactccggcgtggaa
cgattcgtggtggacgacggctggttcggctcccgccgcgacgacacctccggcctcggt
gactggcagattgcgcaggacgtctggcccgatggtccgaagtccctgaaggcgctcgcc
gactacgtgcacgccaagggtatggaattcggcttgtggttcgagccggaaatggtcaac
cccgattccgacgtggcccgcaaccaccccgattggattctttcgcccaccaccggccga
ctgccgctgcagggccgcactcagcaggtgctcgatctgaccaatccggatgcgttcgac
tacatctacggctgcatggaccagcttgtcggcgagcttggtatcgactacatcaagtgg
gaccacaacaagctcgtcaccgagcccggttcccgccgctccggccgcccggccgtgcac
gcgcagacccttgccgtctacaacatcttcaagggcctcaagaccgcacatccgggcctt
gagatcgaaagctgctcctctggtggcggccgcgtggatcttggcatcctggagcacgcc
gatcgtatctgggtctccgactgcgtggacccggtcgagcgcgcggacatccagcgctac
acctcgctgctggtgccgccggcgatgatgggcgagcacgtgggcgccagccccgcacac
tccacccagcgcgccaccagccaggaactgcgcatggccatggcgttcttcggccacatg
ggcatcgaatggaacctgttgaaggagccggacgaggcgctcgccaagctggccgtgtgg
gtggccgaattcaagaagcaccgcgactggttcgccatcgacacctgtgtgcacgccgac
tccaacgatccggccgtgcgtctggacggtatggtgatgccgaaccgtgacgccgccatc
taccgcttcacccagctgaccaccagccagacctatccggccgcgcccgtgcatctgccc
ggacttgaccccgagcgcacctaccgtgtcagcccgcttgacccgagcttggatttgacc
ggtctgaccaacggccagagcactctcggctggtggaacgaggaaggcgtagtcctgacc
ggcgaagccctgcagcgctacggcattcgtcccccgtccctccacccccagcaggcagta
ttgctcaaggctgtggcgttaagctga

DBGET integrated database retrieval system