KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1975Help
Entry
BLIF_1975         CDS       T01420                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:blf00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2366160..2367110
Genome map
AA seq 316 aa AA seqDB search
MSPVISHPRSAAARHQSDELSPITITVDCPAKTNLTLEVGPAHDEWGGRHELDTIYCAIG
VYDTVTATAKQPGAGFSLELEGAYLGDLASSRSDMRRNHAVLALFAMAQAAEREPDVALT
ITKRIPVGAGLGGGSADAAATMLAVNRLWELNWPIERLRTIAATLGADMPFCLTGGLAYG
TGFGERITDIAPGSRDELALIEQGFSGEVLVGAYQSQLSTPEVYHTFDIVGAAEGDRNHL
QAAAISLHPRSGQAIDAATQAGASHAFVSGSGPSVVAFAADEAAAQRIIEVWRDTAVVDR
IIRAKSPEHPNISVRQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggtaatctcacatccacgctcagccgctgcccgacatcagtccgatgagctc
tcccccatcaccattacggtggattgcccggcgaaaaccaatctcaccttggaagtggga
cctgctcacgacgaatggggcggacgccacgaactggacaccatctactgcgcaatcggc
gtatacgacaccgtcaccgcaaccgccaagcaacccggagcaggattctctctggagctc
gaaggcgcttatttgggcgacttggcctcctcacgcagcgacatgcgccgcaaccatgcg
gtactggccctcttcgccatggcccaggcggccgagcgcgagccggatgtggcgttgacc
atcaccaagcgcattcccgtgggtgccggactaggcggcggttcagccgacgccgcggcg
accatgctggcggtcaatcgtctctgggagctgaactggcccatagagcgcctgcgcacc
attgctgccacgttgggcgcggacatgccgttctgcctgaccggtggccttgcatacggc
accggtttcggcgaacgcatcacggatatcgcccccggcagccgcgatgagctggcgctg
atagaacagggattcagcggcgaagtattggtcggcgcataccagtcgcaactcagcact
cctgaggtctaccacacctttgacatcgtgggagccgcagaaggcgaccgcaatcatctg
caggctgcggcaatcagcctgcatccccgcagcgggcaggccatcgacgccgccacgcag
gcgggtgccagccatgcattcgtctccggatccggcccctcagtggtcgctttcgccgcc
gacgaggcagcggcacaacgcattatcgaggtgtggcgcgatacagctgtggtcgatcgt
attattcgagccaaatctcccgaacaccccaatatcagcgtcagacagtga

DBGET integrated database retrieval system