KEGG   Bifidobacterium longum subsp. longum F8: BIL_02860Help
Entry
BIL_02860         CDS       T02580                                 

Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
blg  Bifidobacterium longum subsp. longum F8
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:blg00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:blg00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(332198..333547)
Genome map
AA seq 449 aa AA seqDB search
MGLWDVDKIEYVGRAKGPKEDFAFHYYDADKVVAGKKMKDWLRFGVAWWHTFNQELVDPF
GTGTAHRPYYKYTDPMDQALAKVDYAFELFQKLGVEYFCFHDRDIAPEGDTLRETNANLD
KVVDKIDENMKSTGVKLLWNTSSLFTNPRFVSGAATSPFADIYAYAGGQLKKSLEIGKRL
GAENYVFWGGREGYENLWNTEMKRETDHIAKFFHMCADYAKEIGFEAQFLIEPKPKEPTL
HQYDFDAATAIEFLRNHDLTDVFKLNLEGNHANLAGHTYQHEIRVARESGFLGSLDANQG
DKLIGWDMDEFPTDLYETVAVMWEVLQAGSIGPHGGLNFDAKPRRTSFYEEDLFRSHIAG
MDAYAAGLLVADKMNQDGFIQNLQAERYSSYDSGIGKDIDEGNVTLADLEAYSLDKPQSE
LIAATKSDHLESVKATINNYIIDALAEVE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgtgggatgttgacaagatcgagtacgtcggccgcgccaaaggaccgaaggaa
gacttcgccttccattactacgatgccgacaaggtcgttgccggcaagaagatgaaggat
tggctgcgcttcggcgttgcttggtggcacaccttcaaccaggaactggttgatccgttc
ggcaccggcaccgcgcaccgcccgtactacaagtacaccgatccgatggaccaggctctg
gccaaggtcgactacgccttcgagctgttccagaagctgggcgtcgagtacttctgcttc
cacgatcgtgacatcgcccccgaaggcgacaccctgcgcgagaccaacgccaacctcgac
aaggtcgttgacaagatcgacgagaatatgaagtccaccggtgtcaagctgctgtggaac
acctcctccctgttcaccaacccgcgcttcgtgtccggcgccgccacttctccgttcgcc
gacatctacgcctacgccggtggccagctcaagaagagcttggagatcggcaagcgcctg
ggcgctgagaactacgtgttctggggtggccgcgaaggctacgagaacctgtggaacacc
gagatgaagcgcgagaccgaccacatcgccaagttcttccacatgtgcgcagattacgcc
aaggaaatcggctttgaggcccagttcctgatcgagccgaagccgaaggagccgacgctg
caccagtacgacttcgatgccgccaccgccatcgagttcctgcgcaaccacgacctgacc
gacgtcttcaagctgaacttggaaggcaaccacgccaacctggccggccacacctaccag
cacgagatccgcgtggcccgcgagtccggcttcctcggttccctcgacgccaaccagggc
gacaagctcatcggctgggatatggacgagttcccgaccgatctgtacgagaccgtcgcc
gtcatgtgggaagtcctgcaggccggctccatcggacctcacggtggtctgaacttcgac
gccaagccgcgccgtacctccttctacgaggaggacctgttccgctcccacatcgccggc
atggatgcctacgccgccggcctgctggttgccgacaagatgaaccaggacggcttcatc
cagaatcttcaggccgagcgctacagctcctacgactccggcatcggcaaggacatcgac
gagggcaacgtcaccttggccgacctcgaagcctacagcctcgacaagccgcagtccgag
ctcatcgccgccaccaagtccgatcacctcgagtccgtcaaggccaccatcaacaactac
atcattgatgccctggctgaggtcgagtga

DBGET integrated database retrieval system