KEGG   Bifidobacterium longum subsp. longum F8: BIL_07990Help
Entry
BIL_07990         CDS       T02580                                 

Definition
Sugar kinases, ribokinase family (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
blg  Bifidobacterium longum subsp. longum F8
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BIL_07990
Enzymes [BR:blg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BIL_07990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
961912..962874
Genome map
AA seq 320 aa AA seqDB search
MPEPVRERLRALKDAPGSVIVVGSMNADYTVTTKRLPKPGETVNGGAMKVLPGGKGANQA
SAAARLGVNVQLLGAVGEDSNADFLLSKLDEAGVDTADILHVEGPSGTTVITVSAEGENT
IVYSPGSNAKASAGYVQSHRTTIAECAVLGLCLESPIATVIAAAQTAHDAGVTVLLNDSP
FMDELPHELVEATDILLVNQHEVAQLLGLPDDDVESLDWYEVAERFTDYGFDRAIVTLGA
SGSVVIENGRWHRVSAAQVNAVDTTGCGDSFMGTVLAGLAAGHTLLQSAQIGSYVSAYAA
TKLGAQSAYGTAEEVIAYFS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcccgtacgggagcgattgagagcgctgaaggatgcgccgggctcggtaatc
gtggtcggctcgatgaacgccgattacaccgtaaccactaaacgactacccaagccaggt
gaaaccgtcaatggtggtgccatgaaagtgctgccgggcggcaagggcgcgaatcaggcg
tctgccgccgctcgtctcggtgtcaatgtccagttgctgggcgcggtgggcgaggactcc
aacgcggacttcctattaagcaagctggatgaggccggcgtcgacaccgccgatatcctg
catgtcgaaggccccagcggcaccacggtaatcaccgtgagcgctgagggcgagaacacc
atcgtctattcgccgggttccaatgccaaggcaagtgccggctatgtgcaatcacatcgc
acgaccatcgccgaatgcgcggtattgggactgtgtttggagagcccgattgccaccgtt
atcgccgccgcgcagaccgcgcatgacgctggcgtgaccgtgctgctcaacgactcgcca
tttatggacgagctgcctcacgaactggtggaagccacggatattctgctggtcaaccag
catgaagtggctcaactgctgggcctgccggatgatgacgtggaatcactcgactggtat
gaggtcgccgaacgattcaccgattacggattcgaccgggcgatagtgacgcttggtgcg
tcgggatcggtggtgatcgagaacggacgttggcatcgcgtatccgccgcgcaagtcaat
gcagtggacaccaccggttgcggcgactcgttcatggggaccgtgctggctggcttggcc
gccggtcatacgctgctgcaatccgcgcaaatcggctcctacgtctccgcctatgcggcc
accaagcttggtgcccaaagtgcctacggtaccgccgaagaagtcatcgcctacttcagc
tga

DBGET integrated database retrieval system