KEGG   Bifidobacterium longum subsp. longum F8: BIL_09320Help
Entry
BIL_09320         CDS       T02580                                 

Definition
Aspartate/tyrosine/aromatic aminotransferase (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
blg  Bifidobacterium longum subsp. longum F8
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:blg01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:blg01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:blg00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:blg00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1102659..1104215
Genome map
AA seq 518 aa AA seqDB search
MSVSVFAERLRNAMNSRGLKQVDLVHAAEHRGVKMGKSHISQYVAGKTMPREDVLEFLAS
ELDVDTNWLRGEESTTQLNSDASNSVTDGEHAATPLATGAAKPQTDSEIPVGRRRTFGKS
HKLDNVLYDVRGPVADEAMRMEANGTHILKLNIGNPAPFGFRTPDEVVYDMAHQLTDTEG
YSPSKGLFSARKAIMQYAQLKNIPNVTIDDIYTGNGVSELINLSMSALLDTGDEVLVPSP
DYPLWTACVNLAGGTAVHYLCDEQSEWYPDIDDIRSKITSNTKAIVIINPNNPTGALYPK
EVLQQIVDIAREHQLIIFSDEIYDRLVMDGLQHISIASMAPDLFCVTFSGLSKSHMIAGY
RIGWMILSGNKRIAKDYIEGLNMLANMRMCSNVPAQSVVQTALGGHQSVNDYIVPGGRVH
DQRDLVYDMLNQIPGITAVKPKAAFYIFPKIDVKRFNIHSDEQFALDLLHDKHILISHGG
AFNWHRPDHFRVVYLPRMGMLRETMGEISDFFSYYWQS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtatcggtgtttgcggaacgtctgcgcaatgcgatgaacagcaggggattgaag
caggtcgatttggtgcacgccgccgaacatcgtggcgtaaagatgggcaagagccacatc
agccaatatgtggccggcaagaccatgccccgcgaggacgtgctcgaattcctggccagc
gaactggacgtcgacacgaattggctgcgcggcgaggaatccaccacgcaattgaactcg
gacgcatccaacagcgtcacggacggcgaacacgccgccacaccgcttgccacgggtgcc
gccaagccccagacggacagcgagattcccgtgggccgccgccgcaccttcggcaaatcg
cacaagctcgacaacgtgctctacgacgtgcgcggcccggtcgccgacgaggcgatgcgc
atggaggccaacggcacccacatcctgaaattgaacatcggcaacccggcacccttcggc
ttccgcacgccggacgaagtcgtctacgacatggcccaccagctcaccgacaccgaaggc
tactcgccgtccaagggcctgttctccgcgcgcaaggccatcatgcagtacgcgcagctg
aagaacatcccgaacgtcaccatcgacgacatctacaccggcaacggcgtcagcgagctc
atcaacctgtccatgtccgcgctgctcgacaccggcgacgaagtgctcgtgccctccccg
gactacccgctgtggaccgcctgcgtgaacctggccggcggcaccgccgtgcactacctg
tgcgacgaacagtccgaatggtatccggacatcgacgacatccgctccaagatcaccagc
aacaccaaggcgattgtcatcatcaacccgaacaaccccaccggcgcactttacccaaag
gaagtgctccagcagatcgtcgacatcgcgcgcgaacaccagctcatcatcttctccgac
gaaatctacgatcgcctcgtcatggacggcctgcagcacatctccatcgcctcgatggcc
ccggacctgttctgcgtgaccttctccggcctgtcgaaatcgcatatgatcgccggctac
cgcatcggctggatgattctgtccggcaacaagcgcatcgccaaggactacatcgagggc
ctcaacatgctcgccaacatgcgcatgtgttcgaacgtgcccgcccagtccgtggtgcag
accgcgctcggcggccaccagagcgtcaacgactacatcgtgccgggcggccgcgtgcac
gaccagcgcgacctcgtctacgacatgctcaaccagatccccggcatcaccgccgtcaag
ccgaaggccgcgttctacatcttcccgaagatcgacgtcaaacgcttcaacatccactcg
gacgagcagttcgcgctcgacctgctgcatgacaagcacatcctcatcagccacggcggc
gcgttcaactggcatcgccccgaccacttccgcgtggtgtacctgccgcgcatgggcatg
ctgcgcgaaaccatgggggagatttccgacttcttcagctactactggcagagctga

DBGET integrated database retrieval system