KEGG   Bifidobacterium longum subsp. longum F8: BIL_09320Help
Entry
BIL_09320         CDS       T02580                                 

Definition
(GenBank) Aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
blg  Bifidobacterium longum subsp. longum F8
Pathway
blg00220  Arginine biosynthesis
blg00250  Alanine, aspartate and glutamate metabolism
blg00290  Valine, leucine and isoleucine biosynthesis
blg01100  Metabolic pathways
blg01110  Biosynthesis of secondary metabolites
blg01130  Biosynthesis of antibiotics
blg01210  2-Oxocarboxylic acid metabolism
blg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BIL_09320
   00290 Valine, leucine and isoleucine biosynthesis
    BIL_09320
   00220 Arginine biosynthesis
    BIL_09320
Enzymes [BR:blg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BIL_09320
    2.6.1.66  valine---pyruvate transaminase
     BIL_09320
Amino acid related enzymes [BR:blg01007]
 Aminotransferase (transaminase)
  Class I
   BIL_09320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 HTH_19 HTH_3 HTH_31 Beta_elim_lyase Cys_Met_Meta_PP HTH_26
Motif
Other DBs
NCBI-ProteinID: CBK70478
UniProt: D6DDA7
Position
1102659..1104215
Genome map
AA seq 518 aa AA seqDB search
MSVSVFAERLRNAMNSRGLKQVDLVHAAEHRGVKMGKSHISQYVAGKTMPREDVLEFLAS
ELDVDTNWLRGEESTTQLNSDASNSVTDGEHAATPLATGAAKPQTDSEIPVGRRRTFGKS
HKLDNVLYDVRGPVADEAMRMEANGTHILKLNIGNPAPFGFRTPDEVVYDMAHQLTDTEG
YSPSKGLFSARKAIMQYAQLKNIPNVTIDDIYTGNGVSELINLSMSALLDTGDEVLVPSP
DYPLWTACVNLAGGTAVHYLCDEQSEWYPDIDDIRSKITSNTKAIVIINPNNPTGALYPK
EVLQQIVDIAREHQLIIFSDEIYDRLVMDGLQHISIASMAPDLFCVTFSGLSKSHMIAGY
RIGWMILSGNKRIAKDYIEGLNMLANMRMCSNVPAQSVVQTALGGHQSVNDYIVPGGRVH
DQRDLVYDMLNQIPGITAVKPKAAFYIFPKIDVKRFNIHSDEQFALDLLHDKHILISHGG
AFNWHRPDHFRVVYLPRMGMLRETMGEISDFFSYYWQS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtatcggtgtttgcggaacgtctgcgcaatgcgatgaacagcaggggattgaag
caggtcgatttggtgcacgccgccgaacatcgtggcgtaaagatgggcaagagccacatc
agccaatatgtggccggcaagaccatgccccgcgaggacgtgctcgaattcctggccagc
gaactggacgtcgacacgaattggctgcgcggcgaggaatccaccacgcaattgaactcg
gacgcatccaacagcgtcacggacggcgaacacgccgccacaccgcttgccacgggtgcc
gccaagccccagacggacagcgagattcccgtgggccgccgccgcaccttcggcaaatcg
cacaagctcgacaacgtgctctacgacgtgcgcggcccggtcgccgacgaggcgatgcgc
atggaggccaacggcacccacatcctgaaattgaacatcggcaacccggcacccttcggc
ttccgcacgccggacgaagtcgtctacgacatggcccaccagctcaccgacaccgaaggc
tactcgccgtccaagggcctgttctccgcgcgcaaggccatcatgcagtacgcgcagctg
aagaacatcccgaacgtcaccatcgacgacatctacaccggcaacggcgtcagcgagctc
atcaacctgtccatgtccgcgctgctcgacaccggcgacgaagtgctcgtgccctccccg
gactacccgctgtggaccgcctgcgtgaacctggccggcggcaccgccgtgcactacctg
tgcgacgaacagtccgaatggtatccggacatcgacgacatccgctccaagatcaccagc
aacaccaaggcgattgtcatcatcaacccgaacaaccccaccggcgcactttacccaaag
gaagtgctccagcagatcgtcgacatcgcgcgcgaacaccagctcatcatcttctccgac
gaaatctacgatcgcctcgtcatggacggcctgcagcacatctccatcgcctcgatggcc
ccggacctgttctgcgtgaccttctccggcctgtcgaaatcgcatatgatcgccggctac
cgcatcggctggatgattctgtccggcaacaagcgcatcgccaaggactacatcgagggc
ctcaacatgctcgccaacatgcgcatgtgttcgaacgtgcccgcccagtccgtggtgcag
accgcgctcggcggccaccagagcgtcaacgactacatcgtgccgggcggccgcgtgcac
gaccagcgcgacctcgtctacgacatgctcaaccagatccccggcatcaccgccgtcaag
ccgaaggccgcgttctacatcttcccgaagatcgacgtcaaacgcttcaacatccactcg
gacgagcagttcgcgctcgacctgctgcatgacaagcacatcctcatcagccacggcggc
gcgttcaactggcatcgccccgaccacttccgcgtggtgtacctgccgcgcatgggcatg
ctgcgcgaaaccatgggggagatttccgacttcttcagctactactggcagagctga

DBGET integrated database retrieval system