KEGG   Bifidobacterium longum subsp. longum F8: BIL_18320Help
Entry
BIL_18320         CDS       T02580                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
blg  Bifidobacterium longum subsp. longum F8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BIL_18320
Enzymes [BR:blg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BIL_18320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126885..2129122
Genome map
AA seq 745 aa AA seqDB search
MTDAYGNDAATSTGTIADTTNNAASGAPQRAESTERLARPLIKLAKACGLATSFIDQLGT
YTEISDAALVAVLKALDVDASSDEAIVRSMTQLEVENSKRLLPSTIVATTGKPTGITLNC
SSDADITASIELEDGTAFGHFALLPNLNSGKPDLTIAPDLPMGYHTLTVTVDGREGKAAI
IAAPARIPVPEAVAEHQRWGWMTQMYSVRSRESWGIGDYGDLKRLLADAAEKSKADFMLI
NPIHAGAPIPPLEPSPYLPESRRFLNVTYIRPQDIPEYATLPADVRAQVDALHDSVAARN
DESTPMDINAAWEAKRPALRLIFEAGRNNKRELEFEHFKTTAGPDLDSFATWCLCFEVWG
APWGENRWFFEKTIDDPAVRQLVEEHHDLFEFNRWLQWIAAEQVNAAQQEALDHGMTLGL
MQDMAVGVHGLGADAWANPERFASGGVTVGCPPDFYNQQGQDWGQPPFNPRYLEATGYQV
YREMVHSMYEHAGAVRIDHVLGLFRLWWIPQGLGARNGAYVTYNHEAMLGVLAIEATRAG
GMVVGEDLGTVPDYVRRILADHGVLGTDVEWFNRVDDSPNAGDPYRAPKDYRKQALASVT
THDLPPTAGYLNFAHVKLREELHLLSEPVEAFAASAMAERTAMMNRLVENGYISQTVADD
VEGHVQEIVEAMHAMLTDTPSLLLQAALVDGVGECRSQNQPGTSREYSNWRVPLADSSGH
VVHTDEVFDLPRVQSLAAVMRREKR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcatacggcaacgacgcagcaaccagcaccggcaccatcgcagacaccacc
aacaacgccgcttccggtgccccgcagcgcgcggaaagcacggaacgactcgcccgcccg
ctcatcaagctcgccaaagcctgcggacttgccacctcattcatcgaccagctcggcacc
tacaccgaaatcagcgacgcggccttggtcgccgtactcaaggccctcgacgtggacgca
tccagcgacgaggccatcgtacgctccatgacccaacttgaggtggaaaacagcaaacgt
ttgctcccctccaccatcgtcgccaccaccggcaaaccgaccggcatcaccctgaactgc
tcgtcggacgcggacatcaccgcctccatcgaactggaggacggcaccgcgtttggccac
tttgccctgctgccgaacctcaattccggcaagccggacttgaccatcgcacccgacctg
ccgatgggttaccacacgctgaccgtcacggttgacgggcgcgagggcaaggcggccatc
atcgccgcccccgcgcgcattcccgtgccggaggcggtcgccgagcaccagcggtggggc
tggatgacgcagatgtattccgtgcggtcccgcgaatcgtggggcatcggcgattacggc
gatctgaagcgtcttttggcagatgccgccgagaagtccaaggccgacttcatgctcatc
aatccgattcacgccggcgcgccgattccgccgcttgagccatcgccgtatctaccggaa
tcgcgccgattcctcaacgtgacgtacatccggccgcaggatatccccgaatatgccaca
ctgccggccgacgtgcgcgcgcaggtggatgcgctgcatgattcggtggccgcgcgcaac
gacgaatcgaccccgatggacatcaacgcggcgtgggaggccaagcgcccggcgctgcgc
ctgatcttcgaagcgggccgcaacaacaagcgcgagctcgaattcgagcatttcaagacc
accgccggcccggacctcgattccttcgccacatggtgcctgtgcttcgaggtatggggc
gcgccgtggggcgagaaccgttggttcttcgagaagaccatcgacgacccggccgtgcgc
cagctcgtcgaggagcaccacgacctgttcgagttcaaccgctggctgcagtggatcgct
gccgagcaggtgaacgccgcgcagcaggaggcgctggaccacggcatgacgctggggctg
atgcaggacatggccgtgggcgtgcacgggctcggcgcggatgcctgggccaatccggaa
cgcttcgcctcaggtggcgtcacggtcggctgcccgccggacttctataaccagcagggc
caggattggggccagccaccgttcaacccgcgctacctggaggccaccggctaccaggtg
taccgcgagatggtgcattcgatgtacgagcacgcgggcgcggtgcgcatcgaccatgtg
ctgggcttgttccgcctgtggtggattccgcaggggctcggtgcccgcaacggcgcatac
gtgacgtacaaccacgaggcgatgttgggagtactggccatcgaggccacgcgcgccgga
ggcatggtggttggcgaggatctgggcaccgtaccggattacgtgcgccgcattctggcc
gatcacggcgtgctcggcactgacgtggaatggttcaaccgcgtggacgattcgccgaac
gccggcgacccgtaccgcgcacccaaggactatcgcaaacaggcattggcctcggtgacc
acgcacgatctgccacccaccgccggctacctgaacttcgcacacgtcaagctgcgcgag
gagctgcatctcctgagcgagccggtggaggcattcgccgcctcggcgatggccgagcgc
acggccatgatgaaccgtctggtggagaacggctatatctcgcagaccgtggcggatgat
gtggaaggccatgtgcaggaaatcgtggaagcgatgcacgccatgctcaccgatacgccg
tcgctgctgctgcaggcagcgctggtggacggcgtgggcgaatgccgctcccagaatcag
ccgggcacttccagagagtattcgaactggcgcgtgccgctggcggacagctcaggccac
gtggtacataccgacgaggtcttcgacctgccacgcgtgcagtccctagccgccgtgatg
cgccgagagaagcggtga

DBGET integrated database retrieval system