KEGG   Bifidobacterium longum subsp. longum F8: BIL_20090Help
Entry
BIL_20090         CDS       T02580                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
blg  Bifidobacterium longum subsp. longum F8
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:blg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BIL_20090
  Lipid metabolism
   00561 Glycerolipid metabolism
    BIL_20090
   00600 Sphingolipid metabolism
    BIL_20090
Enzymes [BR:blg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BIL_20090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2361357..2363663
Genome map
AA seq 768 aa AA seqDB search
MAENTSTFTGAAADGTALTAVYLTQPAANVAIGLVFAGSDLPRIVHWGRPLAKPDTLLAA
YDALKPQRVSGALDDTVWPSILPTQAESWIGEQRVVLRRAGVELFPKFTVTNIETGGVLE
ATLDAVSGESYTDVAGHARATGPARVPGVIVTARDEEQGVEVEWHLELLPGGLARQKATV
TNLFGADAGAQLEIGKIELGFPLPESAGEILTTTGHHLRERSPQRQPLTVGRFEKPQLAG
RPDFDASLLLTAGVPGFGFEHGDAYSVHVGWSGNSVLSAERLPYTTGVIGGGELLFGGEV
TLAGPGEGQNSYDTPWLFGSYGDGLNEIAARFHSYVRSLHPRLFSHGRPVILNTWEAVYF
DHNFDTLKALADRAADSGVERFVVDDGWFGSRRDDTSGLGDWQIAQDVWPDGPKSLKALA
DYVHAKGMEFGLWFEPEMVNPDSDVARNHPDWILSPTAGRLPLQGRTQQVLDLTNPDAFD
YIYGCMDQLVGELGIDYIKWDHNKLVTEPGSRRSGRPAVHAQTLAVYNIFKGLKTAHPGL
EIESCSSGGGRVDLGILEHADRIWVSDCVDPVERADIQRYTSLLVPPAMMGEHVGASPAH
STQRATSQELRMAMAFFGHMGIEWNLLKEPDEALAKLAVWVAEFKKHRDWFAIDTCVHAD
SNDPAVRLDGMVMPNRDAAIYRFTQLTTSQTYPAAPVHLPGLDPERTYRVSPLDPSLDLT
GLTNGQSTLGWWNEEGVVLTGEALQRYGIRPPSLHPQQAVLLKAVALS
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacacctcgactttcaccggtgccgccgctgacggtaccgcactcaccgcc
gtctacctgacccagcccgccgccaatgtggcgatcggtctggtgtttgccggcagcgac
ctgccgcgcatcgtccactggggtcgcccgctggccaagcccgacaccctgctggccgcc
tatgacgccctgaagccgcagcgcgtgtccggcgcgctcgacgacaccgtctggccgtcc
atcctgcccacccaggccgaaagctggatcggcgagcaacgcgtggtgctgcgccgcgcc
ggcgtcgagctcttccccaagttcaccgtgaccaacatcgagaccggcggcgtgctggaa
gccaccctcgatgccgtgtccggcgaaagctacaccgatgtggccggccatgcccgcgcc
accggcccggcccgcgtgcccggcgtcatagtcaccgcgcgcgatgaggagcagggcgtg
gaagtcgaatggcaccttgaactgctccccggcggcctggcccgtcagaaggccaccgta
accaacctgttcggtgcagacgccggagcccagctcgagatcggcaagatcgagctcggc
ttcccgctgcccgaatccgccggcgaaatcctcaccaccaccggtcaccatctacgtgaa
cgcagcccgcagcgccaaccgctgaccgtcggccgtttcgaaaagccgcagctcgctggc
cgccctgacttcgacgcatccctgctcctgaccgccggcgtgcccggtttcggcttcgag
catggcgacgcctattcggtgcacgtgggctggagcggcaactccgtactgtccgccgaa
cgtctgccctacacgaccggcgtaatcggcggcggcgaactcctgttcggcggcgaagtg
acgctcgctggtcctggcgaaggccagaactcctacgacaccccgtggctgttcggctcc
tatggcgatggcctcaatgagatcgccgcccgcttccactcctacgtgcgctccctgcat
ccgcgcctgttctcgcacggccgtccggtgatcctcaacacgtgggaagccgtgtacttc
gaccacaacttcgatacgctgaaggcactcgccgacagggccgccgactccggcgtggaa
cgattcgtggtggatgacggttggttcggttcccgccgcgacgacacctccggcctcggt
gactggcagattgcgcaggacgtctggcccgatggcccgaagtcactgaaggcgctcgcc
gactacgtgcacgccaagggtatggaattcggcttgtggttcgagccggaaatggtcaac
cccgattccgatgtggcccgtaaccaccctgattggattctctcgcccaccgctggccga
ctgccgctgcagggccgcactcagcaggtgctcgatctgaccaatccggatgcgttcgac
tacatctacggctgcatggaccagcttgtcggcgagcttggtatcgactacatcaagtgg
gaccacaacaagctcgtcaccgagcccggttcccgccgctccggccgaccggccgtgcac
gcgcagacccttgccgtctacaacatcttcaagggcctcaagaccgcacatccgggcctt
gagatcgaaagctgctcctctggtggcggccgcgtggatcttggcatcctggagcacgcc
gatcgtatctgggtctccgactgcgtggacccggtcgagcgcgcggacatccagcgctac
acctcgctgctggtgccgccggcgatgatgggcgagcacgtgggcgccagccccgcacac
tccacccagcgcgccaccagccaggaactgcgcatggccatggcgttcttcggtcacatg
ggcatcgaatggaacctgttgaaggagccggacgaggcgctcgccaagctggccgtgtgg
gtggccgaattcaagaagcaccgcgactggttcgccatcgacacctgcgtgcacgccgac
tccaacgatccggccgtgcgtctggacggtatggtgatgccgaaccgtgacgccgccatc
taccgcttcacccagctgaccaccagccagacctatccggccgcgcccgtgcatctgccc
ggacttgaccccgagcgcacctaccgtgtcagcccgcttgacccgagcttggatttgacc
ggtctgaccaacggccagagcactctcggctggtggaacgaggaaggtgtagtcctgacc
ggcgaagccctgcagcgctacggcattcgtcctccgtccctccacccccagcaggcagta
ttgctcaaggctgtggcgttaagctga

DBGET integrated database retrieval system