KEGG   Bifidobacterium longum subsp. longum F8: BIL_20090Help
Entry
BIL_20090         CDS       T02580                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
blg  Bifidobacterium longum subsp. longum F8
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:blg00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:blg00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:blg00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2361357..2363663
Genome map
AA seq 768 aa AA seqDB search
MAENTSTFTGAAADGTALTAVYLTQPAANVAIGLVFAGSDLPRIVHWGRPLAKPDTLLAA
YDALKPQRVSGALDDTVWPSILPTQAESWIGEQRVVLRRAGVELFPKFTVTNIETGGVLE
ATLDAVSGESYTDVAGHARATGPARVPGVIVTARDEEQGVEVEWHLELLPGGLARQKATV
TNLFGADAGAQLEIGKIELGFPLPESAGEILTTTGHHLRERSPQRQPLTVGRFEKPQLAG
RPDFDASLLLTAGVPGFGFEHGDAYSVHVGWSGNSVLSAERLPYTTGVIGGGELLFGGEV
TLAGPGEGQNSYDTPWLFGSYGDGLNEIAARFHSYVRSLHPRLFSHGRPVILNTWEAVYF
DHNFDTLKALADRAADSGVERFVVDDGWFGSRRDDTSGLGDWQIAQDVWPDGPKSLKALA
DYVHAKGMEFGLWFEPEMVNPDSDVARNHPDWILSPTAGRLPLQGRTQQVLDLTNPDAFD
YIYGCMDQLVGELGIDYIKWDHNKLVTEPGSRRSGRPAVHAQTLAVYNIFKGLKTAHPGL
EIESCSSGGGRVDLGILEHADRIWVSDCVDPVERADIQRYTSLLVPPAMMGEHVGASPAH
STQRATSQELRMAMAFFGHMGIEWNLLKEPDEALAKLAVWVAEFKKHRDWFAIDTCVHAD
SNDPAVRLDGMVMPNRDAAIYRFTQLTTSQTYPAAPVHLPGLDPERTYRVSPLDPSLDLT
GLTNGQSTLGWWNEEGVVLTGEALQRYGIRPPSLHPQQAVLLKAVALS
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacacctcgactttcaccggtgccgccgctgacggtaccgcactcaccgcc
gtctacctgacccagcccgccgccaatgtggcgatcggtctggtgtttgccggcagcgac
ctgccgcgcatcgtccactggggtcgcccgctggccaagcccgacaccctgctggccgcc
tatgacgccctgaagccgcagcgcgtgtccggcgcgctcgacgacaccgtctggccgtcc
atcctgcccacccaggccgaaagctggatcggcgagcaacgcgtggtgctgcgccgcgcc
ggcgtcgagctcttccccaagttcaccgtgaccaacatcgagaccggcggcgtgctggaa
gccaccctcgatgccgtgtccggcgaaagctacaccgatgtggccggccatgcccgcgcc
accggcccggcccgcgtgcccggcgtcatagtcaccgcgcgcgatgaggagcagggcgtg
gaagtcgaatggcaccttgaactgctccccggcggcctggcccgtcagaaggccaccgta
accaacctgttcggtgcagacgccggagcccagctcgagatcggcaagatcgagctcggc
ttcccgctgcccgaatccgccggcgaaatcctcaccaccaccggtcaccatctacgtgaa
cgcagcccgcagcgccaaccgctgaccgtcggccgtttcgaaaagccgcagctcgctggc
cgccctgacttcgacgcatccctgctcctgaccgccggcgtgcccggtttcggcttcgag
catggcgacgcctattcggtgcacgtgggctggagcggcaactccgtactgtccgccgaa
cgtctgccctacacgaccggcgtaatcggcggcggcgaactcctgttcggcggcgaagtg
acgctcgctggtcctggcgaaggccagaactcctacgacaccccgtggctgttcggctcc
tatggcgatggcctcaatgagatcgccgcccgcttccactcctacgtgcgctccctgcat
ccgcgcctgttctcgcacggccgtccggtgatcctcaacacgtgggaagccgtgtacttc
gaccacaacttcgatacgctgaaggcactcgccgacagggccgccgactccggcgtggaa
cgattcgtggtggatgacggttggttcggttcccgccgcgacgacacctccggcctcggt
gactggcagattgcgcaggacgtctggcccgatggcccgaagtcactgaaggcgctcgcc
gactacgtgcacgccaagggtatggaattcggcttgtggttcgagccggaaatggtcaac
cccgattccgatgtggcccgtaaccaccctgattggattctctcgcccaccgctggccga
ctgccgctgcagggccgcactcagcaggtgctcgatctgaccaatccggatgcgttcgac
tacatctacggctgcatggaccagcttgtcggcgagcttggtatcgactacatcaagtgg
gaccacaacaagctcgtcaccgagcccggttcccgccgctccggccgaccggccgtgcac
gcgcagacccttgccgtctacaacatcttcaagggcctcaagaccgcacatccgggcctt
gagatcgaaagctgctcctctggtggcggccgcgtggatcttggcatcctggagcacgcc
gatcgtatctgggtctccgactgcgtggacccggtcgagcgcgcggacatccagcgctac
acctcgctgctggtgccgccggcgatgatgggcgagcacgtgggcgccagccccgcacac
tccacccagcgcgccaccagccaggaactgcgcatggccatggcgttcttcggtcacatg
ggcatcgaatggaacctgttgaaggagccggacgaggcgctcgccaagctggccgtgtgg
gtggccgaattcaagaagcaccgcgactggttcgccatcgacacctgcgtgcacgccgac
tccaacgatccggccgtgcgtctggacggtatggtgatgccgaaccgtgacgccgccatc
taccgcttcacccagctgaccaccagccagacctatccggccgcgcccgtgcatctgccc
ggacttgaccccgagcgcacctaccgtgtcagcccgcttgacccgagcttggatttgacc
ggtctgaccaacggccagagcactctcggctggtggaacgaggaaggtgtagtcctgacc
ggcgaagccctgcagcgctacggcattcgtcctccgtccctccacccccagcaggcagta
ttgctcaaggctgtggcgttaagctga

DBGET integrated database retrieval system