KEGG   Bacillus licheniformis 9945A: BaLi_c05970Help
Entry
BaLi_c05970       CDS       T02694                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase XynA (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
blh  Bacillus licheniformis 9945A
Brite
Enzymes [BR:blh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     BaLi_c05970 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
593787..594428
Genome map
AA seq 213 aa AA seqDB search
MFKFKKNFLVGVTAALMSISLFSATASAASPDYWQNWTDGGGTVNAVNGPGGNYSVNWSN
TGNFVVGKGWTTGSPSRTINYNAGVWAPNGNGYLALYGWTRSPLIEYYVVDSWGTYRPTG
TYKGTVKSDGGTYDIYTTTRYNAPSIDGEKTTFTQYWSVRQTKRPTGSNAKITFSNHVRA
WKSHGMNLGSIWSYQVLATEGYQSSGSSNVTVW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtttaaaaagaatttcttagttggagtaacggcagctttaatgagtattagc
ttgttttcggcaaccgcctctgcagctagcccagactactggcaaaattggactgatggc
ggcggaacagtaaacgctgtcaatgggcctggagggaattacagtgttaattggtctaat
accggaaatttcgttgttggtaaaggttggactacaggttcgccatctaggacaataaac
tataatgccggagtttgggcgccgaatggcaatggatatttggctttatatggttggacg
agatcacctctcatagaatattatgtagtggattcatggggtacttatagacctactgga
acgtataaaggtactgtaaaaagtgatggcggcacatatgacatatatacaactacacgt
tataatgcaccttccattgatggcgaaaaaactactttcacgcagtactggagtgttcgc
cagacgaagagaccaactggaagcaacgctaaaatcactttcagcaatcatgttagagca
tggaagagtcatggaatgaatctgggtagtatttggtcttatcaagtcttagcgacagag
ggatatcaaagtagtggaagttctaacgtaacagtgtggtaa

DBGET integrated database retrieval system