KEGG   Bacillus licheniformis 9945A: BaLi_c19160Help
Entry
BaLi_c19160       CDS       T02694                                 

Gene name
celB
Definition
putative endoglucanase CelB (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
blh  Bacillus licheniformis 9945A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1876485..1878167
Genome map
AA seq 560 aa AA seqDB search
MREKWLALCLKSIILFVLIMGTVLLSTVPKASGTSGPAKQEKQSIITPADLLENMSPGWN
LGNTLDAVPTEGSWNNPPVREHTFDDIRDAGFKSVRIPVTWDSHIGSAPGYLIDTAWMNR
VEEVTDWALEREFYVVLNIHHDSWLWISRMGNSQQETLDKLGKVWKQIAERFKNKSERLL
FEIVNEPTGMNAYQMNLLNREMLNIIRSTGGNNSQRLVIVGGLEDNKDELLHSFEPPDDD
RIVLTYHYYSPWDYVSNWWGRTTWGSAAEISEMEEDIKPVYEKFVREGYPVIIGEYGTLG
ANENHSKRLYHDTFVRLAHKYQMVPMWWDNGNDQFDRTERQWRDPVVKEIVIQAGRGVPN
AIIKPADLFIKKGQNLSDQTVDIQLTGNVLTGIYQKSEPLKEGSDYTVDNAGKTVSIKES
CLAKLLNGSGQPGVKAQLTFTFHKGASQVMDIILYDDPKLEKSEFTVSQSAISGDLKIPA
SLNGTKLATVKGVVDSTGRPVLEEVWSWTPYLNYDEDFYEKDGDLYLRERVLKYLKSDST
FTFELWPKGVETVVKVKVTP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
ttgagagaaaaatggttagccttgtgtttaaagtcgatcattctgttcgttttgatcatg
ggaaccgttcttttatccacagttccgaaagcttcgggaacaagcgggccagcaaagcaa
gaaaagcagagcatcatcaccccggcagaccttttggaaaacatgagtcccggatggaac
cttggcaacacgctggatgctgttccgacagaaggctcttggaacaatccgccggttcgc
gagcatacttttgatgatattcgcgacgcggggtttaaaagcgtccggattccggtgaca
tgggactcccacatcggcagcgctcccgggtatctgatcgacaccgcttggatgaaccgg
gtggaagaagtgacggattgggcgttggaaagagaattttatgtcgtgttaaatattcac
cacgattcttggctatggatcagccgcatgggaaacagccagcaggagacattagataag
ctggggaaagtctggaagcaaattgccgagcgttttaaaaacaaaagtgaacgcctcctg
tttgaaatcgtcaatgaaccgactggaatgaacgcatatcaaatgaatctgcttaaccgc
gagatgctgaacatcatccgttcgaccggcggcaacaacagccagcggctcgtgatcgtc
ggggggcttgaagataacaaagatgaattgcttcattcatttgaaccgcctgatgatgac
cggattgtcctcacatatcactactattctccgtgggattacgtatcaaactggtggggc
cggacgacttggggatcggcagccgaaatctccgagatggaggaggatatcaaaccggtt
tatgaaaaatttgtaagggaaggatacccggttatcatcggcgaatacggtaccctcggc
gccaatgaaaatcattcaaagcggctctatcatgatacgtttgtccgccttgcccacaaa
tatcaaatggtcccgatgtggtgggacaacgggaatgaccagtttgaccggactgagaga
cagtggcgcgatcctgttgttaaagagattgtcattcaggcgggacgcggcgttcccaat
gcgatcatcaaaccggcagatctttttataaaaaaaggtcaaaacctcagcgatcagacg
gtggacattcagctgaccggcaatgtgctgaccggcatttatcagaaatccgaaccatta
aaggaaggcagtgattatacagttgataatgccggaaaaacggtctctattaaggaatcc
tgcttggcaaagctgctgaacgggtccgggcagcctggggtaaaagcgcagctcactttt
acgtttcataaaggagccagccaggttatggatatcattctttatgatgacccgaagctt
gaaaaaagcgaattcaccgtcagtcaatcggcaatcagcggtgatctcaaaatcccggct
tcactgaacggaacgaagctggctacggttaaaggagtcgtcgattctacaggaaggccg
gttcttgaagaagtatggtcatggacgccctacttgaactatgacgaggatttttatgaa
aaagacggggatttgtatttgagagagcgggttttaaagtatttgaaaagcgattccacc
tttacatttgaactgtggccgaaaggcgtcgagacggtcgtgaaggtgaaagtcacgcct
tga

DBGET integrated database retrieval system