KEGG   Bacillus licheniformis 9945A: BaLi_c21530Help
Entry
BaLi_c21530       CDS       T02694                                 

Gene name
eglS
Definition
endo-1,4-beta-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
blh  Bacillus licheniformis 9945A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BaLi_c21530 (eglS)
Enzymes [BR:blh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BaLi_c21530 (eglS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2085356..2086912
Genome map
AA seq 518 aa AA seqDB search
MSYMKRSISVFIACFMVATLGISGIIAPKASAASQTPVAVNGQLTLKGTQLVNQKGKAVQ
LKGISSHGLQWYGDYVNKDSLKWLRDDWGINVFRAAMYTGEGGYIDNPSVKNKVKEAVEA
AKELGIYVIIDWHILSDGNPNQNKAKAKEFFNEMSRLYGKTPNVIFEIANEPNGDVNWNR
DIKPYAEDILSVIRKNSPKNIVIVGTGTWSQDVNDAADNQLKDGNVMYALHFYAGTHGQS
LRDKADYALSKGAPIFVTEWGTSDASGNGGVYLDQSREWLKYLDSKKISWVNWSLCDKQE
SSAALNSGASKKGGWSQSDLSSSGKFVRENIRSGSNGSSGDSGSDSKGSDQKDQKKDQDK
PGQDSGAAANTIAVQYRAGDNNVNGNQIRPQLNIKNNSKKTVSLNRITVRYWYKTNHKGQ
NFDCDYAQIGCSKITHKFVQLKKAVNGADTYLEVGFKNGTLAPGASTGEIQIRLHNDNWS
NYAQSGDYSFSSGSNTFKNTKKITLYENGKLIWGAEPK
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacatgaaacgttccatttctgtcttcatcgcctgcttcatggtagcaacactc
ggcatcagcggtatcatcgcacctaaagcgtctgccgcttctcaaacacccgttgctgta
aacggacagctcaccttgaaaggtacgcagctcgttaatcaaaaaggaaaagcggttcag
ctgaaaggaatcagttcacacgggctgcagtggtatggcgattatgtcaacaaagactcg
ttaaaatggctgagagacgactggggcatcaatgtcttccgcgcggctatgtatacgggt
gaaggcggctatattgacaatccgtcggttaaaaacaaagtgaaggaagccgtcgaagcg
gcaaaagaactcggaatctatgtgatcatcgactggcacatactgagcgacggcaatcca
aaccaaaacaaagcgaaagcaaaagagtttttcaacgaaatgtcaaggctttacggcaag
acgccaaacgtcatttttgaaattgccaacgagccgaacggcgatgtcaactggaaccgt
gacattaaaccttacgctgaagacattttgtccgtgatccgcaaaaattctccgaaaaat
attgtgatcgttgggacaggcacttggagccaagatgtcaacgatgcggcggacaatcag
ctgaaagacggcaatgtcatgtacgcgcttcatttttatgcgggtacgcacggtcagtct
ttgcgagataaagcagactatgcactcagcaaaggagcgccgattttcgtcacagaatgg
ggaacgagcgatgcttccggaaacggcggtgtctacctcgaccaatccagggagtggctg
aaatatttagacagcaaaaaaatcagctgggtaaactggagcttgtgcgacaaacaagag
tcgtcagctgctttaaactccggcgcctctaaaaagggaggatggtctcaatccgactta
tcctcatcaggtaaattcgtcagagaaaacatccgcagcggatcaaacggttcgtcagga
gactctggatcggattcgaaagggtcagatcaaaaagaccagaaaaaggatcaggataaa
ccaggtcaagacagcggcgctgcagccaacacgatagcagtacaatacagagcgggggac
aacaatgtaaacggcaaccaaatccgccctcagctcaacattaaaaacaacagcaaaaaa
accgtgtctttaaatcgaatcactgtccgctattggtataaaacgaatcacaaaggacaa
aattttgactgcgactatgcccaaatcggctgcagcaaaatcacgcacaaattcgtccaa
ttaaaaaaagcggtaaacggagcagacacgtatcttgaagtaggatttaaaaacggtaca
ttagcgccgggtgcaagtacaggcgaaatccagatccgtcttcacaatgacaactggagc
aattatgcccaaagcggcgactattcattttcttcaggttcaaacacgtttaaaaatacg
aaaaaaatcacgttgtatgagaatggaaaactgatttggggcgctgaacctaaataa

DBGET integrated database retrieval system