KEGG   Bacillus licheniformis 9945A: BaLi_c23450Help
Entry
BaLi_c23450       CDS       T02694                                 

Gene name
odhA
Definition
2-oxoglutarate dehydrogenase E1 component OdhA (EC:1.2.4.2)
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
blh  Bacillus licheniformis 9945A
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:blh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BaLi_c23450 (odhA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BaLi_c23450 (odhA)
  Amino acid metabolism
   00310 Lysine degradation
    BaLi_c23450 (odhA)
   00380 Tryptophan metabolism
    BaLi_c23450 (odhA)
Enzymes [BR:blh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BaLi_c23450 (odhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2324420..2327254)
Genome map
AA seq 944 aa AA seqDB search
MFQNSMKQRMTWEEFHGPNLGYVLELYDQYVKDPESLDADLKEMFDELGAPPGDIRAASL
KNEEADFTAGSIQKIASVIKLAEDIRTYGHLNASVNPLRKTQEKQELFPLAEYGLTEQDV
KKIPASVICKDAPKEVTNGLEAIQYLKNTYKKSISFEFDHVHIFEERNWLMKKIESGELF
APKSKEKLVEVLRRLTEVESLEQFLHKTFVGQKRFSIEGLDALVPMLDDIIAKSVSAGTT
NVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSTGINYGWTGDVKYHLG
ANRQIQDEHTKTARIALANNPSHLEFIDPIVEGSTRAAQETRTESGYPLQDVKKSLAILI
HGDAAFPGEGIVAETLNLSQLKGYQVGGAIHIIANNMIGFTTESNESRSTKYASDLAKGF
EIPIVHVNADDPEACLSAVQLAVEYRMTFNKDFLIDLIGYRRFGHNEMDEPSATQPMLYD
AVRKHPTVKNIFAEKLIHNGIVDNETVDKIGDAVMKRLEEAYRKVPAKKEDMTHEIVLPE
PVSNGFPDVDTSVDVETLRKINQELVSWPENFNVFDKLKRILERRAKAFDDDRKVDWSLA
EAMAFASILKDGTPLRLTGQDSERGTFAHRNLVLHDSKTGDEFIALHHLADTKASFAVHN
SPLSEGSVLGFEYGYNVSSPETMVIWEAQFGDFANAAQVYFDQFISAGRAKWGQKSGLVV
LLPHGYEGQGPEHSSGRTERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
IIMTPKSLLRNPNTVSEVQELSDSNFKPVYEMSGLSHQYDKVTRLVLSSGKVSIDISSHF
NKMEGEKDWLHIARVEELYPFPAKHIKAIFSKLPNLEEIVWVQEEPQNMGAWNYIEPYLR
EIAPKDVKVRYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaatagtatgaaacaaagaatgacttgggaagaatttcacggtccgaacctc
ggctatgtgctggagctttacgatcaatacgtcaaggatccagaaagcttggatgctgat
ttaaaagagatgtttgacgaacttggagctcccccgggcgatataagggccgcctctcta
aaaaacgaagaggcagatttcacggctggatctattcaaaaaatcgcatcagtgataaaa
ctcgcagaagatattagaacctatggccatttaaacgcttccgtcaatccactgagaaaa
acacaagagaaacaggagctttttcctcttgctgagtacgggttaactgagcaggatgtg
aaaaaaattccggcgtctgtcatatgcaaagatgcccctaaagaagtaacgaacggttta
gaagccatccagtacttgaaaaacacatacaaaaaatcgatttcttttgaatttgaccat
gtgcacatttttgaagagcgcaactggctgatgaaaaagatcgaatccggggaattattc
gccccgaaatcgaaagaaaagctggtggaagttttaagaaggctgacagaagttgaaagc
cttgaacagtttctccacaaaacctttgtcgggcaaaaacgcttttcaatagaaggactt
gatgcgcttgtgcccatgctggatgatattatcgccaagtccgtttcggcaggtacgaca
aacgttaatatcggaatggcgcacaggggccgcctgaacgttcttgcgcatgtgctcgga
aaaccttatgaaatcattttttctgaattccagcatgcgccgaacaaagatctcgttccg
tcggaaggttcgacagggatcaattacggctggacgggtgacgtaaaatatcacctcggc
gccaaccgtcagattcaggatgagcatacgaaaacggcgcgcattgcgctcgcgaacaat
ccgagccacctggagttcatcgatccgatcgttgagggatcgacaagagccgcccaggaa
acgagaacggagagcggctatccgcttcaagacgttaaaaaatcgctggcgattctgatt
cacggcgatgcggcattcccaggggaaggcattgtcgcggaaacgctgaatttaagccag
cttaaaggctatcaggtgggcggagcgattcacattatcgccaataacatgatcggcttt
acgacggaaagcaatgagtcaagatcaacgaaatatgcaagcgaccttgcaaaaggtttt
gagattccgatcgtccacgtcaatgcggatgatcctgaagcatgcctttcagcggttcag
ctcgctgttgaataccgcatgactttcaacaaagactttttgatcgatctgatcggctac
cgccgtttcggccacaatgaaatggatgagccgtctgcaacgcaaccgatgctgtatgat
gcggtcagaaagcacccgaccgtcaagaacatctttgctgaaaagctgattcataacggg
atcgtcgataatgaaaccgtcgacaaaatcggggacgctgtcatgaagcgtttagaagaa
gcctatcgcaaagtgccggccaaaaaggaagatatgacgcatgaaatcgttcttccggaa
cctgtttccaacggttttccggatgttgacacgtcggttgatgttgaaactttgcgcaaa
attaatcaggagcttgtttcatggcctgaaaacttcaacgttttcgataagctaaagcga
atcctcgaaaggcgcgccaaagcgttcgacgatgaccgaaaagtcgactggtcgcttgca
gaggcgatggcttttgcatccattttgaaagacggcacacctctaaggctgaccgggcag
gattcagaacgcggcacattcgcacaccgcaaccttgtccttcacgacagcaagacaggg
gacgaattcatcgcactgcatcaccttgcagatacgaaagcgtcatttgcggttcacaac
agcccgctttctgaaggatccgtccttggctttgaatatggatataacgtgtcttcgccg
gaaacgatggtgatctgggaagcgcagtttggagactttgcaaacgcggcgcaagtgtac
tttgatcagttcatttctgcaggaagagcgaaatggggacaaaaatcagggctcgttgtt
ctcttgccgcacggctatgaagggcagggacctgagcattcaagcggaagaacggaacgc
ttccttcagctggcggcggaaaacaactggactgtcgccaacttgacgagcgctgcccag
tatttccatattttaagaaggcaggcgaagatgctccttcgcgaggagatccgcccgctg
atcatcatgacgccgaaaagcctgctgagaaatccgaataccgtatcagaagtgcaggag
ctcagcgacagtaactttaagccggtctatgaaatgtcaggactttcccatcagtatgac
aaagtgacgcgcctcgtcctttcaagcggtaaagtttcgattgacatcagcagccatttc
aataaaatggaaggtgaaaaagattggctgcatattgcacgggttgaagagctgtatcct
ttccctgcaaagcatattaaagcgatcttcagcaaactcccgaatttggaggagattgtc
tgggtacaggaagaaccgcaaaatatgggtgcatggaactatatcgagccttatttaaga
gagattgctccaaaggacgtgaaggtccgctatattggcagaagaagacgttcaagtccg
gcagaaggggatccgacggttcataaaaaggaacaggaacgcattgtatctgatagcttg
actcgcaaaaattaa

DBGET integrated database retrieval system