KEGG   Bacillus licheniformis 9945A: BaLi_c25220Help
Entry
BaLi_c25220       CDS       T02694                                 

Gene name
gudB
Definition
NAD-specific glutamate dehydrogenase GudB (EC:1.4.1.2)
Orthology
K00260  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
blh  Bacillus licheniformis 9945A
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blh00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BaLi_c25220 (gudB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BaLi_c25220 (gudB)
   00330 Arginine and proline metabolism
    BaLi_c25220 (gudB)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BaLi_c25220 (gudB)
Enzymes [BR:blh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     BaLi_c25220 (gudB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2483599..2484873)
Genome map
AA seq 424 aa AA seqDB search
MVADQNTGHTEENTHDVLKSTQTVIHKALEKLGYPEEVYELLKEPIRFLTVKIPVRMDDG
SVKIFTGYRAQHNDAVGPTKGGIRFHPGVTEKEVKALSIWMSLKCGIIDLPYGGGKGGII
CDPRDMSFPELERLSRGYVRAISQIVGPTKDVPAPDVFTNSQIMAWMMDEYSRIDEFNSP
GFITGKPLVLGGSHGRESATAKGVTICIKEAAKKKDIDIEGASVVVQGFGNAGSYLAKFM
YDAGAKVVGISDAYGGLYDPEGLDIDYLLDRRDSFGTVTKLFNDTITNKELLELECDILV
PAAIENQITAENAHNIKAKIVVEAANGPTTLEATKILSDRGILLVPDVLASAGGVTVSYF
EWVQNNQGFYWTEEEVEERLEKMMVKSFNNIYEMAHNRRIDMRLAAYMVGVRKMAEASRF
RGWI
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtagccgatcaaaacaccggtcatactgaagaaaacacacatgacgttttgaaatca
acgcaaacggtgatacataaggcgcttgaaaaattggggtatcctgaagaggtgtatgaa
ttactaaaagaaccgatccgttttttaacggtgaaaattccggttcgcatggacgatgga
tctgttaagattttcacgggctaccgagcccagcacaatgatgcagtagggccgacaaaa
ggcggcatccgttttcatccgggagttacagaaaaagaagttaaagcgctttctatttgg
atgagtctgaaatgtggcatcatcgaccttccatatggaggcggaaagggcgggatcatc
tgtgatccgcgggatatgtcctttcctgaactggaacgtttaagcagagggtacgtccgg
gcgatcagccaaattgtcggaccgacaaaagacgtgccggctcccgatgtatttaccaat
tctcaaatcatggcatggatgatggacgaatattcaagaatcgacgaattcaactcgccg
ggcttcattaccggcaaaccgctcgttttaggtggttctcacggcagagaatctgcgaca
gcaaaaggggttacaatctgcattaaagaggcggcgaaaaagaaagacatcgacattgag
ggagcttctgtcgtcgtgcaggggttcggaaatgcgggaagctaccttgcgaaattcatg
tatgacgcgggtgcaaaagttgtcggcatttctgatgcatacggcggcctgtatgatcct
gaagggcttgacatcgattacctgcttgaccgccgggacagctttggaacggtcacaaag
ctgtttaatgacaccattacaaacaaagaactgctggagctggaatgcgacattctggtg
ccggctgcaatagaaaatcaaattaccgcggaaaacgcccataacatcaaggcgaaaatc
gttgtcgaagcagccaacggcccgacgacgctcgaagcgacgaaaattctttccgaccgc
ggcattcttcttgtaccggacgtgctggcaagcgccggcggtgtaaccgtatcgtatttt
gagtgggtgcaaaacaaccagggattctactggactgaagaagaagttgaagaacgtttg
gaaaaaatgatggtcaaatcgttcaacaatatttacgaaatggcgcacaaccgcagaatc
gacatgcggcttgcagcctatatggtgggcgtccgcaagatggcggaagcatcccgcttc
agaggctggatatag

DBGET integrated database retrieval system