KEGG   Bacillus licheniformis 9945A: BaLi_c26500Help
Entry
BaLi_c26500       CDS       T02694                                 

Gene name
phoB
Definition
alkaline phosphatase PhoB (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
blh  Bacillus licheniformis 9945A
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:blh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BaLi_c26500 (phoB)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BaLi_c26500 (phoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BaLi_c26500 (phoB)
Enzymes [BR:blh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BaLi_c26500 (phoB)
Exosome [BR:blh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BaLi_c26500 (phoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2644350..2646011)
Genome map
AA seq 553 aa AA seqDB search
MGFLRNRIVGITLAGAVALGSAGTGSAAMETAKKKEQPKVKNVIMMVMDGTSSSATTLAR
WYKGEPLAMDQIVSGGVRTHSAESAITDSAPAATAMATGRKSNSSYIGVLPSKVNTPGVE
KVGKKDQYRPVANVLEGAKQKGKATGIIATSEIQHATPAGYSGHHKDRNNFEVLGEQQVY
QNMDVVLGGGKESLQPGTKDKSRKDGEDLVKVLKDKKYDFVETKDQLLKSKSKKIWGAFS
QRDLAYDMDRRATHPEQPTIAEMTKKSIQTLSKDKDGFFLFVEGSKPDWAAHQNDPIGMI
SDVLAFDNAVKEALEFAKKDKHTMVIAVSDHGNSGISIGNSNTTKGYDTTPVSAYIDPLK
KAKMTVEGATGKLKDDLSNIEEAAKLYGLDDLTPAEKEQLKSVKNKKEAASLFTKLLSNR
ANIGFTTGGHTGEDVFLYSYGPEKPQGLVDNTGIAKTMAKAMGFNLDKLTNELFIEAKQA
FKKAGASVTIDQKDPANPVLVASRKKGKAEMPVNKNLIRINGKEYELDSVIVESNGSFYV
PKEAVQLFKKYAR
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcttacgcaacagaatcgtcggcattacactggcaggcgcagtcgctttagga
tcagcgggaacaggcagtgcagcaatggaaacagcgaaaaagaaggaacaaccaaaggtc
aaaaacgtgatcatgatggtcatggatggaacaagctcttctgcaacaacattggcacgc
tggtataaaggcgaaccgctcgcgatggaccagattgtcagcggcggtgtccggacgcat
tcggcagaatcggcgatcactgattctgcacctgcagcaactgcgatggcaacgggacga
aaatcaaattcttcctatattggagtgctgccttcaaaggtgaatacaccaggtgtcgag
aaggtcggtaaaaaagatcaataccggcctgtggcaaacgtgctggaaggcgccaaacag
aagggaaaagcaactggcattattgcaacctctgaaattcagcatgcgacgcctgccggc
tattccggccatcataaggaccgcaataactttgaagtactcggtgaacagcaggtttat
caaaacatggacgttgtccttggcggaggaaaagaatcgcttcagccggggacaaaggat
aaaagccgcaaagacggtgaagaccttgtcaaagtgctcaaagataaaaagtacgatttt
gttgaaacgaaagatcagctcctcaagtcaaaatcgaaaaaaatttggggcgcattctca
cagcgcgatctcgcgtatgacatggaccgccgtgcaacgcatccagagcagccgacgatt
gcggagatgacgaaaaaatcgattcagacgctttctaaagacaaggacggtttcttttta
ttcgtggaaggaagcaagcctgactgggcagcgcatcaaaacgatccgatcggcatgatc
agcgatgtattggcatttgataacgcggtgaaagaagcgcttgaattcgctaaaaaagac
aaacatacaatggttattgccgtctcagaccacggcaacagcggcatctccatcggcaac
agcaacacgacgaaaggctatgacacaacgccggtatcagcatatatcgatccgctgaaa
aaggctaaaatgacggtggaaggcgcaaccggcaaattaaaagacgatttatcgaatatc
gaagaagcggcaaagctttacggacttgatgatttaacgccggcagagaaggaacagctg
aaaagcgtgaaaaacaaaaaagaagcggcttcattattcaccaagctgctcagcaaccga
gccaacatcggattcacaacaggcggtcatacaggtgaagatgtcttcctgtattcgtac
ggtcccgaaaagccgcaggggctcgtcgataacaccggcatcgctaaaacgatggcaaaa
gcaatgggcttcaacttagacaaattaacaaacgaattatttatcgaagcaaaacaggca
tttaaaaaagccggagccagcgtaacgatcgatcagaaagatccggctaatccagttctt
gtcgcatcgcgcaaaaaagggaaagccgaaatgccggtgaacaaaaacctcatcagaatc
aacggaaaggaatatgaattagacagcgtgattgttgaaagcaatggatccttctacgtg
ccgaaggaagcagttcagctgttcaaaaaatacgcccgataa

DBGET integrated database retrieval system