KEGG   Bacillus licheniformis 9945A: BaLi_c29470Help
Entry
BaLi_c29470       CDS       T02694                                 

Gene name
cypB
Definition
bifunctional cytochrome P450/NADPH-cytochrome P450 reductase YrhJ (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
blh  Bacillus licheniformis 9945A
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:blh00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BaLi_c29470 (cypB)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BaLi_c29470 (cypB)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BaLi_c29470 (cypB)
Enzymes [BR:blh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BaLi_c29470 (cypB)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BaLi_c29470 (cypB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2930310..2933534)
Genome map
AA seq 1074 aa AA seqDB search
MNMLNGIPIPKTYGPLGNLPLLDKNKVSQSLWKIADEMGPIFQFKFADAIGIFVSSHELV
KEVSDESRFDKNMGKGLLKVREFSGDGLFTSWTKEPNWRKAHNILLPSFSQKAMKGYHPM
MQDIAVQLIQKWSRLNQDESIDVPDDMTRLTLDTIGLCGFNYRFNSFYREGQHPFIESMV
RGLSEAMRQTKRFPLQDKLMVQTKRQFDSDVESMFSLVDRIIADRKQAGGESGNDLLSLM
LHAKDPETGEKLDDENIRYQIITFLIAGHETTSGLLSFAIYLLLKHPDKLKKAYEEADRV
LTDPVPSYKQVQQLKYIRMILNESIRLWPTAPAFSLYAKDETVIGGKYLIPKGQSVTVLI
PKLHRDQSVWGEDAEGFRPERFEQMDSIPAHAYKPFGNGQRACIGMQFALHEATLVLGMI
LQYFDLEDHANYQLKIKESLTLKPDGFTIRVRPRKKEAMMVTPGAQPEENMRQEEKPSAP
AAENTHGTPLLVLYGSNLGTAEEVAKELAEEAREQGYRSRTAELDQYPGALPAEGAVIIV
TASYNGNPPDCAREFVNWLEHDQTGDLHGVKYAVFGCGNRSWASTYQRIPRLIDSALENR
GAQRLHKLGEGDAGDDFEGQFESWKNDLWPLLRTEFSLSEPDPNQTETDRQAISVEFVSA
PAAAPLAKAYQVFTAKISANRELQCEESGRSTRHIEISLPEGTAYQEGDHLGVLPQNSGV
LIERVFQRFGLNGDEQILISGRNQASHLPLERPVHVKDLFQHCVELQEPAARAQIRELAA
HTVCPPHQRELEDLLKDDVYKNQVLKKRLTMLDLLEQYPACELPFARFLALLPPLKPRYY
SISSSPQLNPRQTSITVSVVSGPALSGRGQYKGVASNYLAGLAPKDAISCFIREPQSGFR
LPEDPETPVIMVGPGTGIAPYRGFLQARRIQRDAGIKLGEAHLYFGCRRPDEDFLYRDEL
EQAEKDGIVHLHTAFSRLEGRPKTYVQDLLREDADMLIHLLNEGGRLYVCGDGSRMAPAV
EQALCEAYRIVQGASQEESESWLSGLLEEGRYAKDVWDGGVSQHDVNADSIART
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgttaaatggaattccaatccctaaaacttacgggccgctcggcaacctgcct
ttgcttgacaaaaacaaggtctcccagtctctttggaaaatcgcggacgagatggggcct
atctttcaatttaagtttgcggatgcgattgggatatttgtgtccagccatgaactggtg
aaagaagtctctgacgagtcccggtttgacaaaaacatggggaaggggctattgaaggtt
cgcgagttcagcggagacgggctgtttacgagctggacgaaggaacccaattggcggaaa
gcccacaatatccttctgccgagcttcagccaaaaagcgatgaagggataccatcccatg
atgcaggacatcgccgtccagctcatccaaaagtggtcccgtctcaatcaggatgaaagc
attgatgtaccggatgatatgacgcggctgacgctggatacgatcggtttatgcggattt
aactaccgctttaacagcttttaccgcgaaggacagcatccgtttatcgagagcatggtc
cgggggttgagtgaagcgatgagacagacgaaacgctttccgctgcaggataagctgatg
gtccaaacgaagcgtcagtttgacagcgatgttgagtcgatgttttctcttgttgaccgg
atcatcgctgaccggaagcaggccggcggcgaaagtggaaatgaccttttatcgcttatg
cttcatgcgaaagaccctgagaccggcgaaaaactggatgatgagaatatccgctatcaa
atcattacgtttttgatcgccgggcacgagacgacgagcggtttattatcgtttgcgatc
tatctgctcctgaagcatccagataagcttaaaaaagcgtatgaagaagcagaccgcgtg
ctgactgatcccgttccttcttacaaacaggttcagcagctgaaatacatccgaatgatt
ttgaatgaatcgataaggctttggccgacggcgccggctttctctctttacgcaaaagac
gaaacggttatcgggggaaaatacttgattccgaaaggccagagcgtcacagtgctcatc
ccaaaactgcacagggatcaaagcgtctggggagaagatgccgaggggttccggcctgaa
cggttcgagcagatggacagcattccggcgcacgcatacaaaccgtttggcaacggccaa
agggcatgcatcggcatgcagttcgcccttcacgaagcgacgcttgtgctcggcatgatt
cttcagtactttgatcttgaagatcatgcaaactaccaattgaagatcaaagaatcgctg
acattaaaaccggatggcttcacaatcagggtaaggccgaggaaaaaagaagcaatgatg
gtgacaccgggtgctcaacctgaagagaacatgcggcaggaagaaaagccttccgcaccg
gctgcggaaaatacgcacggaactcctctccttgtgctttacggttcaaatctcggcaca
gccgaagaggttgcaaaggagcttgctgaagaagcgcgtgagcaaggataccgaagccgg
acggcggagcttgatcaatatccaggcgccctcccggcagaaggggctgttatcattgtg
acggcttcctataacggaaacccgcccgattgcgcaagggaatttgtcaattggcttgag
catgatcagacaggcgatttgcacggtgtcaaatatgcggtattcggctgcggtaaccgg
agctgggccagcacctaccagcggattccgcgcctgattgacagcgcattggaaaataga
ggcgcccaaaggctgcacaagctcggagaaggggacgcaggcgatgattttgaaggacag
tttgaatcatggaaaaacgatctgtggccgcttttaagaaccgaattttcattgtccgaa
cccgatccgaatcaaacagaaacagacaggcaagccatatctgtcgagtttgtaagcgca
cctgcggctgcgccgctggctaaagcttatcaggtgtttacagcgaaaatatcggcaaac
cgggaactgcagtgtgaagagagcggaagaagcacgaggcatattgaaatatcgcttcct
gaaggtaccgcatatcaggagggagaccatctcggggtgcttccgcaaaacagcggggtg
ctgattgaacgtgtttttcagcggtttgggctgaacggagatgaacaaattttgatcagc
ggccggaatcaagcatcacatttgcctttggagcggcctgttcatgtcaaggatcttttt
caacattgcgtcgagctccaggaaccggccgcaagggcccagattcgcgagttggcggca
catactgtttgtccgcctcatcagcgcgagcttgaagacctgctgaaagatgacgtctat
aagaatcaagtgttgaaaaaacggctgacaatgcttgacctgcttgaacaatacccggcc
tgtgaactgccgttcgcccgctttctggcgcttctgcctccgctaaaaccgaggtattac
tcgatttccagttcgccgcagcttaacccgcggcaaacaagcatcaccgtctctgtcgta
agcggcccggcattgagcggccgcgggcaatataagggggtcgcatcgaactatctcgca
ggccttgcgccgaaagacgcgatttcttgtttcatcagggagccccagtcaggcttcagg
cttcctgaagatcctgaaacaccggtgatcatggtcggaccgggcaccggaatcgcacct
taccgcggatttcttcaggcgcgccgcatccagcgcgatgccgggataaagctcggggaa
gcgcatttgtacttcggctgccgccgtccggacgaagattttctgtatcgagacgaattg
gagcaagcggaaaaggacggaatcgtccatttgcatacagcgttttccaggcttgaaggc
cgtccgaaaacatatgtgcaagatttgctcagagaggatgcagacatgctgattcacttg
ttgaacgaaggcggccgcctgtatgtgtgcggagacggaagccgcatggctcccgctgtt
gaacaagctttgtgtgaggcgtaccgcattgtacagggagcgagtcaggaagagtcggaa
agctggctgtccggacttttggaagaagggcgctatgcaaaggatgtgtgggacggcggc
gtttcccaacatgacgtgaatgcggacagcatcgcaagaacataa

DBGET integrated database retrieval system