KEGG   Bacillus licheniformis 9945A: BaLi_c35610Help
Entry
BaLi_c35610       CDS       T02694                                 

Definition
putative pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
blh  Bacillus licheniformis 9945A
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BaLi_c35610
   00500 Starch and sucrose metabolism
    BaLi_c35610
Enzymes [BR:blh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     BaLi_c35610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3530338..3531291)
Genome map
AA seq 317 aa AA seqDB search
MVNREAAAIRLTVSKDGDGEFQTVQEAIDALPEYSREQKVIFIKKGVYKEVVHIPATKPF
VKLIGENRYETVITYDNYAGKEKEGGGKYGTTGSSSVFIYADHVEAENLTFENSFDRTKV
DTTDTQAVAVYAKGNRMTFKYVRFIGRQDTLFVNDGTQYFYQCYIEGDVDFIFGGARAVF
EECQIHSADRGSATNNGYVTAASTHIAKPFGLLITNCRVTSDAADGTVYLGRPWHPGGDP
DAIASVLYHRCDLGAHIKPEGWTDMSGFSAADARLYEYGNTGPGAISHEARRQLADHEAE
KWTIENVLDGWNPKVES
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggttaatcgggaggcagctgctatacggctgacggtttcgaaggatggagacggcgaa
tttcaaaccgttcaagaggcgatcgatgctttgcctgagtacagtcgggaacagaaagtg
atattcattaaaaaaggagtttacaaagaagtcgttcatattccggctacaaagccgttt
gtgaagctgatcggcgaaaatcgttacgagactgtgattacgtatgacaactatgccgga
aaagaaaaggaaggaggagggaaatacggcacgaccggaagttcaagcgtgtttatttat
gcggatcatgttgaagccgaaaatttgacgtttgaaaactcgttcgaccgcacgaaagtc
gacacgaccgatacgcaagcggtggcggtttatgcgaaaggaaacaggatgacgttcaaa
tatgtcaggtttataggcagacaagatacactgtttgtcaatgacggtacacaatatttt
tatcaatgctatatagaaggcgatgtcgatttcattttcggaggagcaagagctgtgttt
gaagagtgccagatccatagcgctgaccgcgggtccgctacaaacaacggttatgtgaca
gctgcgagcacgcatatcgcaaagccgttcggtttattgataacaaactgcagagtgaca
agcgatgccgcagatggaacggtatacctcgggcgcccatggcatccgggaggagacccc
gacgccatcgccagtgtgctatatcaccgctgcgatttaggcgcacacatcaagcctgaa
ggatggacggatatgtcgggcttttctgcggccgatgccagattgtacgaatacgggaat
acgggtccgggtgcgatttcgcatgaggcccgaaggcagcttgccgatcatgaggctgag
aaatggacaattgaaaacgtattggacggctggaatcctaaagttgaatcatag

DBGET integrated database retrieval system