KEGG   Bacillus licheniformis 9945A: BaLi_c36500Help
Entry
BaLi_c36500       CDS       T02694                                 

Gene name
yvaK
Definition
carboxylesterase YvaK (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
blh  Bacillus licheniformis 9945A
Brite
Enzymes [BR:blh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BaLi_c36500 (yvaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3632530..3633276)
Genome map
AA seq 248 aa AA seqDB search
MKIVKPQPFTFKGGKKAVLLLHGFTGNTADVRMLGRYLNEKGYTCHAPQYKGHGVPPEEL
LSTGPEDWWKDVMNGYEYLKSEGYEQIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMYI
KSEETMYEGVLEYARNYKKFEGKAAEQIDAEMEEFKKTPMNTLKALQDLIADVREHVDMI
YSPTFVVQARHDHMINTDSANIIYNEVETDDKQLKWYEESGHAITLDKEREALHKDVYQF
LETLDWQT
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgtcaaaccacaacctttcacatttaaaggcggaaaaaaagcagtcctgctg
ctgcacggatttacgggcaacacggcggacgtgagaatgctcggaagatatttgaatgaa
aaaggctacacatgccatgcgccccaatataaaggccacggcgtgcctccggaagaactt
ctttccacagggccggaagactggtggaaagacgtcatgaacgggtatgaatatttgaaa
tcggaagggtatgaacaaatcgccgcttgcggtctgtctctcggaggggttttttcattg
aaattgggttacactgtacccataaagggaattgttccaatgtgcgcgccgatgtatatc
aaaagcgaagagacgatgtacgagggtgtgcttgagtatgcccgcaattataagaaattt
gaaggcaaggcagcggaacagattgacgctgagatggaagaattcaaaaaaacgccgatg
aacacgttgaaagcactgcaggatttgattgccgatgtcagagagcatgtggacatgatc
tattcgcctacatttgtcgtgcaggcgcgccacgatcatatgattaatacggacagcgcg
aacatcatctacaatgaagttgaaacggatgataagcagctgaaatggtatgaagaatcc
ggtcatgccatcacattggataaagaacgcgaagcactgcacaaggatgtgtatcaattt
ttagaaacgctggattggcagacataa

DBGET integrated database retrieval system