KEGG   Bacillus licheniformis 9945A: BaLi_c38530Help
Entry
BaLi_c38530       CDS       T02694                                 

Gene name
rbsK
Definition
ribokinase RbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
blh  Bacillus licheniformis 9945A
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BaLi_c38530 (rbsK)
Enzymes [BR:blh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BaLi_c38530 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3841427..3842314
Genome map
AA seq 295 aa AA seqDB search
MTMSKICVIGSSSMDLVVTSPKRPAAGETVLGESFKTVPGGKGANQAVAAARLGAEVHMI
GCVGDDHYGKAILDNFQANGVLTDYVEPVTGQESGTAHIVLADGDNSIIVVKGANDHVTP
EYVQKALPAIKQADIVLIQQEIPEETVDYVSGLCSSLGIPLLLNPAPARPLRPETVDLAA
YITPNEHEASVLFQGMSREEALKRYPEKLFITEGKNGVRYHNGLEERIVPSFPVNAIDTT
GAGDTFNAGLAVALSEGQSIESALRFANRAASLSVLKFGAQGGMPKRDEVERELS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgagtaaaatatgcgtgattggcagctcttcgatggatttagttgtgacatcg
cctaagcggccggctgccggagaaacggtgcttggcgaatcttttaaaacggttccgggc
ggaaaaggcgccaaccaggcagtggctgcggcccggcttggtgcagaggtccatatgatc
ggctgcgtcggcgatgatcattacggaaaagccatcctcgacaattttcaagcgaatggt
gttttgacagactatgtggaaccggttacaggtcaggaaagcggcaccgcacatatcgtt
ctcgcagacggcgacaacagtattatcgtcgtcaaaggggcaaatgaccatgtcacacct
gaatacgttcaaaaagcgctgcctgcgattaaacaggcagacatcgttctgattcagcag
gagattccggaagaaaccgtcgattatgtcagcggactgtgcagctctctcggcattcct
ctcctgctgaatccggcaccagctcgtccgcttcgcccggaaacggtcgatcttgcggcc
tacattacgccaaacgagcatgaagcttcggtactgtttcagggcatgtcccgggaggaa
gcgttaaagcgctatccggagaagctgttcatcacagaaggaaaaaacggggtccgctat
cacaatggtctggaagaaaggatcgtcccttcattccctgtcaatgcaattgatacgacg
ggagccggagacaccttcaatgcgggattggccgttgcgctttccgaaggacaaagcatc
gaatctgccttgcgctttgcgaaccgggcggcttccctctcggttttgaaattcggcgcg
caaggcggcatgccgaaacgggatgaagtggagcgtgaattgtcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system