KEGG   Bacillus licheniformis 9945A: BaLi_c40600Help
Entry
BaLi_c40600       CDS       T02694                                 

Gene name
xylA
Definition
xylose isomerase XylA (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
blh  Bacillus licheniformis 9945A
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:blh00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:blh00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4053467..4054876)
Genome map
AA seq 469 aa AA seqDB search
MVKQTCYLTFALQGKVKGEIGMFFKNVGMIEYEGADSENPYAFKYYNPDEYVGGKTMKEH
LRFAVAYWHTFDADGKDPFGDGTMFRAWNRMTHPLDKAKARAEAAFEFFEKLGVPYFCFH
DVDIVDEGATLRETFAYLDQMSSFLKEMMETSRVQLLWNTANMFTHPRYVHGAATSCNAD
VYAYAAAKVKKGLDIAKELGAENYVFWGGREGYETLLNTDMKLELENLASFYRMAVEYAR
EIGFDGQFLIEPKPKEPTKHQYDFDAATTIAFLETYGLKDHFKLNLEANHATLAGHTFEH
ELRVAALHDVLGSIDANQGDLLLGWDTDEFPTDLYSAVLAMYEILKAGGFKTGGINFDAK
VRRPSFADEDLFHAHIAGMDTYAVGLKVASRLLEDKALDQVIEERYESYTKGIGLEIKEG
RTDLKKLAAYALEHDQIENQSGRQERLKATVNRYLLNALREAPAEKETR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggttaaacaaacttgttatttaacgtttgctttgcaaggaaaagtgaagggggagatc
ggaatgttttttaaaaatgttggaatgattgagtatgaaggagccgattcggaaaatcct
tacgcatttaaatattacaaccctgatgaatacgtcggcggcaaaacgatgaaggaacat
cttcgcttcgctgttgcgtattggcatacctttgatgcggacgggaaagaccctttcggc
gacgggacgatgttccgggcgtggaaccggatgacacatcctttggataaagcaaaagcc
cgggcggaagcggcttttgaattttttgaaaagctcggcgtgccctatttctgctttcat
gacgttgatatcgttgatgaaggagcaacgttgcgtgagacctttgcgtatttggatcaa
atgtcgtcttttcttaaagaaatgatggagactagccgtgttcagctgctttggaataca
gccaatatgtttacccatccgaggtatgtccacggagccgcaacttcctgcaatgcagat
gtctatgcctatgcggccgcaaaagtgaaaaaagggctggacatcgccaaggagcttgga
gcggaaaattatgtgttctggggcggaagagaaggttatgaaacattgctgaatacagat
atgaagcttgaactcgaaaacttggcttcattttacagaatggcggttgagtatgcgcgc
gaaatcggttttgacggccaatttttgatcgagccgaagccgaaagagccgacgaagcac
caatacgattttgatgcggccacaacgatcgcctttttagaaacttacggtttaaaagac
cattttaaactcaatcttgaggcgaaccatgcgaccttggccgggcatacatttgagcat
gaactaagggtggctgccttgcacgatgtgctgggttccattgacgccaatcagggcgat
ttgctcctgggctgggataccgatgagttcccgaccgatctgtattctgcggtactggcg
atgtatgaaattttgaaagcaggcgggtttaaaaccggcggcattaacttcgatgctaaa
gtaaggcgcccgtcttttgcggatgaagacttatttcacgctcatatcgcaggaatggat
acgtatgcagtcggcttgaaagtcgcctcccgtctgcttgaagacaaagcgctcgaccag
gtcattgaagaacgttatgaaagctatacgaaaggcatcgggcttgagatcaaagaaggc
cgcaccgatctgaaaaagctcgccgcatacgctcttgaacacgaccaaattgaaaatcag
tcaggccgccaggaacgactgaaagcgaccgttaaccgttacttattgaacgctttgcgc
gaagcgccggcagaaaaggagacacgctag

DBGET integrated database retrieval system