KEGG   Bacillus licheniformis 9945A: BaLi_c41210Help
Entry
BaLi_c41210       CDS       T02694                                 

Gene name
katX
Definition
catalase KatX (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
blh  Bacillus licheniformis 9945A
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:blh00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:blh00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4112347..4113945)
Genome map
AA seq 532 aa AA seqDB search
MDQHSNEQKSDMETDETLTNRQGHPITNNQHIRTVGNRGPSTLENYDFLEKISHFDRERV
PERVVHARGAGAHGYFEAYGTAGDEPVSKYTRAKLFQEKGKRTPVFVRFSTVTHGISSPE
TLRDPRGFAVKFYTEDGNWDLVGNNLKIFFIRDAVKFPDLIHAFKPDPVTNLQDGERIFD
FISNTPEAMHMITFLFSPWGIPANYRQMQGSGVNTYKWVNQEGEAVLVKYHWEPKQGIKN
LTQKEAEEIQAKNFNHATQDLYEAIERGDYPEWELFVQIMSDDEHPELDFDPLDDTKLWP
EEQFPWLPVGKMVLNKNPEDYFTEVEQAAFGTGVLVDGLDFSDDKMLQGRTFSYSDTQRY
RVGANYLQLPINAPKKRVATNQRGGQMQYKVDLGKNQSPHINYEPSTINGLKEAKQDGKE
YTPHVEGNLVRESIERQNNFKQAGDTYRHFEDWEKDELITNLVNTLAPCDQRIQTKMIEM
LKQCDKEYGSRVEEGLKNASSQNTSSREPIGAEGAEDAPRQAEEKGHSEDPY
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcattcaaacgagcagaaatctgacatggagacggatgagacgttaacgaac
cggcagggccacccgatcacaaacaatcagcatatcaggaccgtgggcaaccgggggcct
tccacattggagaactatgatttcttggagaagatcagccactttgacagggagagggtt
cccgaacgggtcgtccatgccaggggggccggagcgcacggctattttgaagcttatgga
acagcaggcgatgagccggtctcaaaatatacgagagcaaaactgtttcaggaaaaaggg
aagagaaccccggtgtttgtccgtttttcgacggtgacccacgggatatcttcaccggaa
acgcttcgcgatccccgcggatttgccgttaagttttacacggaggacgggaactgggat
ctagtcggaaacaacttgaagatcttctttatccgcgatgcggtgaagtttcctgattta
atccatgcatttaagccggacccggttacgaatttgcaggatggcgaaagaatctttgac
ttcatttccaacacgcctgaagccatgcacatgatcacatttttgttttctccttggggc
attccggcaaactaccggcagatgcaggggtccggtgtcaacacgtacaaatgggtaaac
caagaaggagaagccgtccttgtgaagtatcactgggaaccgaagcagggcataaaaaac
ttgacgcaaaaagaggcggaagaaattcaggcgaagaacttcaatcacgctacacaggat
ttatacgaagcgattgagcggggagactatcccgagtgggagttgttcgttcaaatcatg
agcgatgatgagcatcctgaactcgattttgatccgcttgacgatacgaagctatggcct
gaggagcaatttccttggcttcctgtcggcaaaatggtattaaacaaaaatcccgaagac
tactttacagaagtcgagcaagcggcatttggaacaggggttcttgtcgacggacttgat
ttttccgatgacaaaatgcttcagggacgtacgttttcctactctgatacacagcgatac
agggtaggggccaactatctgcagctgccgatcaatgcgccgaaaaaaagggtggcaacc
aatcagcggggcggccagatgcagtacaaggtcgacttaggcaaaaatcaaagcccgcac
atcaactatgaaccttcaactatcaacgggctgaaagaagcgaagcaggacggcaaagaa
tatacaccgcatgtcgaaggaaatctggtgcgcgaaagtatcgaaaggcagaataatttc
aagcaggccggggacacgtacaggcatttcgaagactgggaaaaggacgagctgattacg
aatctggtcaatacacttgccccctgcgatcaaagaattcaaacgaaaatgatcgagatg
ctcaagcaatgcgacaaggaatatggcagcagggtcgaagaaggattaaaaaacgcttcc
agccaaaatacatccagccgggagccgatcggggcagaaggcgccgaagatgcgccgaga
caggcggaagaaaaaggccatagtgaagatccttattaa

DBGET integrated database retrieval system