KEGG   Bacillus licheniformis 9945A: BaLi_c42840Help
Entry
BaLi_c42840       CDS       T02694                                 

Definition
alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
blh  Bacillus licheniformis 9945A
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BaLi_c42840
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BaLi_c42840
   00620 Pyruvate metabolism
    BaLi_c42840
   00650 Butanoate metabolism
    BaLi_c42840
  Lipid metabolism
   00071 Fatty acid degradation
    BaLi_c42840
  Amino acid metabolism
   00350 Tyrosine metabolism
    BaLi_c42840
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BaLi_c42840
   00626 Naphthalene degradation
    BaLi_c42840
Enzymes [BR:blh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BaLi_c42840
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BaLi_c42840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4301347..4303950
Genome map
AA seq 867 aa AA seqDB search
MAIEEKEMKQKQNASTMVDQLVEKGLKALEEFRSFDQEQIDEIVKQMALAGLDQHMPLAK
LAVEETKRGVYEDKIIKNMFATEYVYHHIKYDKTVGIINENEHDGVIEIAEPVGVIAGVT
PVTNPTSTTMFKSLIAIKTRNPIVFAFHPSAQKCSREAARILRDAAVKAGAPDNCIQWIE
TPSLNATQALMTHPNVSLILATGGAGMVKSAYSSGKPALGVGPGNVPCYIEKSANLKQAV
NDLILSKTFDNGMICASEQAVIIDKDIYSDVKVEMTRNNCYFLNETEKSKVEKLVINENT
CAVNADIVGMPAFKIAEMAGVKVPQDTKILIAELEGVGPDYPLSREKLSPVLACYKVSGI
QEGLKRAEDMLAFGGTGHSAVIHTNDQEAVKEFGLRMKAGRIIVNAPSSQGAIGDIYNAY
MPSLTLGCGTYGGNSVSSNVGAVHLINTKKVAKRNVNMQWFKVPPKIYFEKHATQYLAKM
PDISKALIVTDPGMVKLGYVDRVLHYLRRRPDYVHCEIFSDVEPDPSIETVMNGVDMMAK
FQPDVIIALGGGSAMDAAKGMWLFYEHPDAEFFGLKQKFLDIRKRIVKYPKLGEKAKFVA
IPTTSGTGSEVTSFSVITDKETNTKYPLADYELTPDVAIIDPQFVMTVPKHITADTGMDV
LTHAIESYVSCMANDYTDGLAMKAIQLIFEYLPRAYKNGSDELAREKVHNASTIAGMAFS
NAFLGINHSLAHKLGAEFHIAHGRANAILLPHVIRYNAEKPKKFTAFPKYSHFIADQRYA
EIARTLGLPAKTTAEGVESLIQEIISLAKELKIPMSIKQNGVDAAAFESKVDLMAERAFE
DQCTTANPKLPLVSELAEIYRSAYKGV
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaagaaaaggaaatgaaacaaaagcaaaatgcctcaaccatggttgatcag
ctagtcgaaaaaggcctaaaggcattggaagaattccgcagctttgatcaggagcagatt
gatgagatcgtcaaacagatggcgcttgccggccttgatcagcacatgcctctcgccaaa
cttgccgtcgaagaaacgaagcgcggcgtttatgaagataaaatcattaaaaacatgttt
gccacagagtatgtctaccatcatatcaaatacgataaaacagtgggcatcatcaatgaa
aacgaacacgacggagtcattgaaatcgcggagcctgtcggtgtcatcgccggcgtgacg
ccggtgaccaaccctacttccactacaatgttcaagtccctgatagcgatcaaaacaaga
aaccctatcgtgtttgctttccatccatcggcccaaaaatgcagccgcgaagcggcgaga
atccttcgggacgcagccgtcaaagcaggagcacccgacaactgtatccaatggattgaa
acgccttcgctgaatgcaactcaagccttaatgacccatccgaacgtttccctgattctc
gcaacagggggcgccggcatggtgaaatcagcgtacagctccggaaaaccggcccttggc
gtcggacctggaaacgttccgtgctacatcgagaagtctgccaacctgaagcaagccgtc
aatgatctgatcttatccaaaacatttgacaacggcatgatttgcgcatcagagcaggcc
gtcatcatagacaaagacatctactcagacgtcaaagtcgaaatgacaagaaacaactgc
tatttcttaaatgaaaccgaaaaatcaaaggtcgagaaattggtcatcaatgaaaatact
tgcgcggtaaacgctgatatcgtcggcatgccggcattcaaaatcgctgaaatggccggt
gtcaaagtgcctcaagatacaaaaatcctcatcgccgaattagaaggcgtaggtccggat
tacccgctttccagggaaaaactgagccctgttttagcgtgctacaaagtcagcggaatt
caagagggattaaaacgcgccgaagacatgctcgcgttcggtggaaccggccactcggcg
gtaattcatacgaacgatcaagaagccgttaaagaattcggattacggatgaaagccggg
cggatcatcgtcaatgcaccgtcgtcacaaggggcgatcggcgacatttacaacgcctat
atgccttctttaacactcggatgcggcacatatggcggaaactccgtctcgtcaaacgtt
ggagctgttcatttaatcaacacgaaaaaagtggcgaaaaggaatgtcaatatgcagtgg
tttaaagttcctccaaaaatctattttgaaaaacacgcaacccaatatttagcgaaaatg
cctgacatctcaaaagcgttgattgtgactgatccggggatggtgaaactcggatatgta
gaccgcgtcctacactacttaagaaggcgcccggattacgttcattgtgaaattttttct
gatgtcgagcctgatccttcaatcgaaacggtgatgaacggcgtcgacatgatggccaaa
ttccagccggatgtcatcatcgccctcggcggaggttctgcaatggatgccgcaaaagga
atgtggttgttctatgagcacccggatgctgaattctttggattaaagcaaaaattcctg
gacatccgcaagcgcattgtcaaatacccgaaactgggcgaaaaagcaaaattcgtcgcg
atcccgacgacatcaggcacaggctctgaagtcacttcattctctgtcattacagacaaa
gaaacgaatacgaagtatccgctggccgactatgaattaacgccggacgtcgcgatcatt
gacccgcaatttgtcatgaccgtgccgaaacatattacggctgacacaggaatggacgta
ttaactcacgcaattgaatcatacgtatcgtgcatggctaacgactatacagacggcttg
gccatgaaggccatccagctgatcttcgaatacctgcctagagcatacaaaaacggcagc
gacgagctggcccgcgaaaaagtgcataatgcatcaacgattgccggaatggcgttttcc
aatgccttccttggcatcaaccacagcttagcccataagcttggcgcggagtttcacatc
gctcatggacgggcaaacgccatccttctgccgcacgtgatccgctataatgcagaaaag
ccgaaaaagttcacggcatttcctaaatacagccacttcatagccgatcagcgctacgcg
gagattgccagaacgctcggcctgcctgcaaaaacaactgcagaaggcgttgaaagcctg
atccaggagattatctcgctcgccaaagagcttaaaattccgatgagcattaaacaaaac
ggcgtggatgctgccgcattcgaaagcaaagtggatctcatggccgaacgcgcctttgaa
gatcagtgtacgacagccaatccgaagctgccgctcgtttcggagcttgctgagatttac
cgttccgcatataaaggagtttag

DBGET integrated database retrieval system