KEGG   Bacillus licheniformis ATCC 14580: BL00003Help
Entry
BL00003           CDS       T00197                                 

Gene name
ytpA
Definition
lysophospholipase YtpA
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BL00003 (ytpA)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BL00003 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3073819..3074598)
Genome map
AA seq 259 aa AA seqDB search
MWCMEAERPVATIVVIHGACEHHGRYKWLSEMWRSSGFNVVMGDLPGQGTSTRERGHIRS
FQEYIDEVDKWVARAKAFELPVFMLGHSMGGLIAIEWFKQQQSGIAGLILSSPCLGLQLK
PNKFLDLISKGLNVLAPSMRFESGITPDKATRNKEVIEMDINDSLYITKVSVRWYQEMLK
ALKSAMEPTDAFLNIPLFVMQAGTDWLVDKKMVVKWFNQLASHNKTYREWDGLYHEIFNE
PEREDVFKAARAFAEQYIT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgcatggaagcggaaagacctgttgctacaatcgtcgtcattcacggtgcatgt
gagcatcacgggcggtataaatggctgtccgaaatgtggcgttcatccggctttaatgtc
gtgatgggggatttgcccggccagggcacttcgacaagagaaagaggacatatacgctct
tttcaagaatatattgatgaagtggacaaatgggtcgccagggcgaaagcatttgaactg
cctgtgtttatgctcgggcacagcatgggcggcctgattgcgatcgaatggtttaagcag
cagcaaagcggcattgccggtctcattttatcatccccttgtctcgggctgcaattaaag
ccgaacaaatttctggacttgatttccaaggggctcaacgttttggcgccgtctatgcgg
tttgaatccgggatcacgcctgataaagcgacgagaaacaaagaagtcatcgaaatggac
atcaacgattcattatatatcacaaaagtttctgtcagatggtatcaagaaatgttaaaa
gcgttgaaaagcgcgatggagccgacggacgcctttctcaacatcccgctctttgtcatg
caggcgggcaccgactggcttgtcgacaaaaaaatggtcgtcaagtggtttaaccagctt
gcttcccacaataagacgtacagggaatgggatggcttgtaccacgaaattttcaatgag
cctgaacgggaagacgtttttaaagcggccagagcgtttgcggagcagtatataacataa

  All links  
No link information was found.   
DBGET integrated database retrieval system