KEGG   Bacillus licheniformis ATCC 14580: BL00035Help
Entry
BL00035           CDS       T00197                                 

Gene name
ytjP
Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bli01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bli00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3032130..3033521)
Genome map
AA seq 463 aa AA seqDB search
MNWEQEVLKRRNEIVEDIQGFLKINSVLDEETAGPGRPFGKGIQECLTALLNKGEESGFT
VKNLDGYAGHIEWGKGEEIIGVLCHIDVVPPGDGWTSDPFAAEIRGGRIYARGALDDKGP
TMAAFHALKIVKDSGLPLSKRIRMIIGTDEESDWRCVEHYFKHEEMPSAGFAPDADFPII
YAEKGLIDAALKIETDQAETGADLVLEAFRSGRRLNMVPDDAEAVLAGAVPSEFEESFAR
FVKEKRAEGRILQEGGRLTLTVHGKSAHAMEPNNGVNAGLILAEFLHTQSLDRAGLHFVQ
TVSGAFAGDTRGKKIGIGCRDDISGELTLNVGRLQYEQGKGGEAHINIRYPVTEESGRVK
SGLSQIKGARLISFKDSKPHHVAKDHELIKTLQRVYEEQTGETAQLISIGGATYARSLKA
GVAFGPLFPGRPDVAHQKDEYMEIDDLLKAVSIYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaacaggaagttttaaaaagacggaatgagatcgttgaggatattcagggt
tttttaaaaatcaacagcgtccttgacgaagagacggcgggtccgggacggccgtttgga
aaagggattcaagaatgcctgacagcgcttctgaataaaggggaggaaagcgggtttacg
gtaaaaaaccttgacggttatgcaggccatatcgaatgggggaaaggcgaggagattatc
ggcgtgctttgccacattgatgtcgttcctcccggcgatggatggacgagcgacccgttt
gcagctgaaataaggggcggccgaatctatgcaagaggagcgcttgatgataaagggccg
acaatggccgcgtttcatgcattaaaaattgtcaaagactcgggcctccctttatcaaaa
cggatcagaatgattattggaaccgatgaagaaagcgactggcgctgtgtggagcattac
tttaaacacgaagaaatgccttcggccggttttgcgcctgatgctgattttccgattatc
tatgcagaaaaaggcctgattgacgcagctttaaaaattgaaactgatcaggcggaaaca
ggtgcggacttagtattggaggcattccggtccggccggcgcctgaacatggtgcctgat
gatgcggaagccgtcctggcaggggccgtcccgtcagaatttgaagagtcatttgcccgg
tttgtaaaagaaaaacgcgcagaagggcgtattcttcaagaaggcggcagactgacatta
accgtgcacggcaaatcggctcatgccatggaacctaataacggagtcaatgccggtctc
attttggccgagtttttacatacacaatcccttgacagagccgggctccattttgttcaa
acggttagcggggcttttgccggagatacgagagggaaaaagatcggcatcggctgccgc
gatgacatcagcggagagctgacgctgaatgtcggccggctgcagtatgaacaaggaaaa
ggcggggaggcccatattaacatccgctatcctgttactgaagagagcggccgggtgaaa
tccgggctttcacaaataaaaggcgcccggctcatcagctttaaagacagcaagccacat
catgtagcaaaagaccatgaactgatcaaaacgctgcagcgggtctatgaagagcagaca
ggggaaacggcacaattaatttccatcggcggggcgacatatgcacgatcactgaaagcc
ggcgtggcattcggcccgctgtttccaggccgtcctgacgttgcccatcagaaagacgag
tatatggaaatcgacgatttgctgaaggctgtatcgatttatgcacaggccatttatgaa
ttggcgaagtag

DBGET integrated database retrieval system