KEGG   Bacillus licheniformis ATCC 14580: BL00115Help
Entry
BL00115           CDS       T00197                                 

Gene name
bglD
Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bli00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2479520..2480935)
Genome map
AA seq 471 aa AA seqDB search
MSKTEPQLEQIQYRFPNGFWWGSAASATQTEGAAAEGGKGKNIWDHWYEKEPNRFFDGVG
PEKTSRFYETYREDIQLMKELGHHSFRFSISWARLFPDGKGRLNKEGAAFYNRVIDELLA
AGIEPFVNLYHFDMPLALQQIGGWENRQVVDHFASYAETCFRLYGDRVKKWFTHNEPIVP
AEGGYLYDFHYPNIVDFQKAVQVAYHEILSNAKAVEAYRRLGGDGKIGIILNLTPSYPRS
QHPADVRASEIADAFFNRSFLDPAVKGEFPQLLTDILKEEGYLPVMEEGDLELIKNHTVD
LLGINYYQPRRVKAKEHLPHPDAPFMPERFFDHYEMPGRKMNRHRGWEIYEKGIYDILIN
VKENYGNIECFISENGMGVEGEERFRGEDGMIRDDYRISFIKEHLKWVHRAIQEGANVKG
YHLWTFMDNWSWTNAYKNRYGFVSVNLDKNGERTIKKSGYWFKKVAENNGF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaacagaaccgcagctagaacaaattcaataccgttttccaaatggcttctgg
tgggggtcggcggcttccgccactcagactgaaggagcggcggccgaaggaggcaaagga
aagaacatttgggatcactggtacgaaaaagagccaaaccgattttttgacggagtaggc
cctgagaagacttcgcgtttttacgagacttacagagaagatattcagctgatgaaagag
cttggccaccactcttttcgtttctccatttcgtgggctcgtctgtttcctgatggaaaa
gggcggctgaacaaagaaggagctgccttttataaccgagtcatcgatgaactgcttgcg
gctggcatcgagccttttgtcaacctttatcattttgacatgccgcttgcgctccagcaa
atcggcggatgggaaaacaggcaagtcgtcgatcactttgcttcatacgcggaaacgtgc
ttcaggctgtacggggaccgagtgaaaaaatggtttacccacaatgagccgatcgttcct
gcagaaggcggctatctatacgattttcactatccgaacatcgtcgactttcaaaaagcc
gtccaggtcgcataccatgaaattctttcaaacgctaaagctgtcgaagcttatcgcaga
ctcgggggcgacggcaaaatcggcatcattttaaatttaacgccgtcctacccgcgaagc
cagcatccggcagatgtaagagcatctgaaatagccgacgctttctttaaccgatcgttt
cttgatcccgccgttaagggtgagtttccgcagcttttaacagatatattaaaagaagaa
ggctatttgcctgtcatggaagaaggagacttggagctgatcaaaaatcacactgtcgat
ctgctcggcatcaattattatcagccgagacgggtgaaagcgaaggagcacctgcctcat
ccggacgcgccttttatgccggaacggttttttgaccattatgaaatgcccggacgaaaa
atgaaccgccaccgcggctgggagatatatgaaaaaggaatctatgatattttaatcaat
gtcaaagaaaactacggaaatattgaatgctttatttctgaaaatgggatgggcgttgaa
ggagaagaacgtttccgcggcgaagacggcatgatccgcgatgactacagaatttcgttt
ataaaagaacacttaaaatgggtgcacagagccattcaggaaggagcgaatgtcaaaggc
tatcatctttggaccttcatggacaactggtcatggacgaacgcctataaaaaccgctac
ggttttgtatctgtcaaccttgacaaaaacggcgaacgaacgattaaaaaaagcggatac
tggtttaagaaagttgccgagaacaacggtttttaa

DBGET integrated database retrieval system