KEGG   Bacillus licheniformis ATCC 14580: BL00199Help
Entry
BL00199           CDS       T00197                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00010  Glycolysis / Gluconeogenesis
bli00071  Fatty acid degradation
bli00350  Tyrosine metabolism
bli00620  Pyruvate metabolism
bli00625  Chloroalkane and chloroalkene degradation
bli00626  Naphthalene degradation
bli00650  Butanoate metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01120  Microbial metabolism in diverse environments
bli01130  Biosynthesis of antibiotics
bli01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL00199
   00620 Pyruvate metabolism
    BL00199
   00650 Butanoate metabolism
    BL00199
  Lipid metabolism
   00071 Fatty acid degradation
    BL00199
  Amino acid metabolism
   00350 Tyrosine metabolism
    BL00199
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BL00199
   00626 Naphthalene degradation
    BL00199
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BL00199
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BL00199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AAU25725
UniProt: Q65CW1
Position
4137757..4140360
Genome map
AA seq 867 aa AA seqDB search
MAIEEKNMKQKQNASNMIDQLVEKGLKALEEFRSFDQEQIDEIVKQMALAGLDQHMPLAK
LAVEETKRGVYEDKIIKNMFATEYVYHHIKYDKTVGIINENEHDGVIEIAEPVGVIAGVT
PVTNPTSTTMFKSLISIKTRNPIVFAFHPSAQKCSREAARILRDAAVKAGAPDNCIQWIE
TPSLDATQALMTHPNVSLILATGGAGMVKSAYSSGKPALGVGPGNVPCYIEKSANLKQAV
NDLILSKTFDNGMICASEQAVIIDKGIYSDVKAEMTRNNCYFLNKTEKSKVEKLVINENT
CAVNADIVGMPAFKIAEMAGIKVPQDTKILIAELEGVGPDDPLSREKLSPVLACYKVSGL
EEGLKRAEEMLAFGGTGHSAVIHTNDQEAVKEFGLRMKAGRIIVNAPSSQGAIGDIYNAY
MPSLTLGCGTYGGNSVSSNVGAVHLINTKKVAKRNVNMQWFKVPPKIYFEKHATQYLAKM
PDISKAFIVTDPGMVKLGYVDRALHYLRRRPDYVHCEIFSDVEPDPSIETVMNGVDMMAK
FQPDVIIALGGGSAMDAAKGMWMFYEHPDAEFFGLKQKFLDIRKRIVKYPKLGGKAKFVA
IPTTSGTGSEVTSFSVITDKETNTKYPLADYELTPDVAIIDPQFVMTVPKHITADTGMDV
LTHAIESYVSCMANDYTDGLAMKAIQLIFEYLPRAYKNGSDELAREKVHNASTIAGMAFS
NAFLGINHSLAHKLGAEFQIAHGRANAILLPHVIRYNAAKPKKFTAFPKYSHFIADQRYA
EIARTLGLPAKTTAEGVESLIQEIISLAKELKIPMSIKQNGVDAAAFESKVDLMAERAFE
DQCTTANPKLPLVSELAEIYRSAYKGV
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaagaaaagaacatgaaacaaaagcaaaatgcctcaaacatgattgatcag
ctagtcgaaaaaggcctaaaggcattggaagaattccgcagctttgatcaggagcagatt
gatgagatcgtcaaacagatggcgcttgccggccttgatcagcacatgcctctcgccaaa
cttgccgtcgaagaaacgaagcgcggcgtttatgaagataaaatcattaaaaacatgttt
gccacagagtatgtctaccatcatatcaaatacgataaaacagtgggcatcatcaatgaa
aacgaacacgacggagtcattgaaatcgcggagcctgtcggtgtcatcgccggcgtgacg
ccggtgaccaaccctacttccaccaccatgttcaagtccctgatatcaattaaaacaaga
aatccaatcgtgtttgctttccatccatccgcccaaaaatgcagccgcgaagcggcgaga
atccttcgggacgcagccgtcaaagcaggagcacccgacaactgcatccaatggatcgag
acgccttctctggatgcaacgcaagccctaatgacccacccgaacgtttccctgatcctc
gcaacaggaggcgcaggcatggtgaaatccgcttacagctccggaaaaccggcccttggc
gtcggacctggaaacgttccgtgctacatcgagaagtctgccaacctgaagcaagccgtc
aatgatctgatcttatccaaaacatttgacaacggcatgatttgcgcatcagagcaggcc
gtcatcatagacaaaggcatctactcagacgtcaaagccgaaatgacaagaaacaactgc
tatttcttaaataaaaccgaaaaatcaaaggtcgaaaaattggtcatcaatgaaaatact
tgcgcggtaaacgctgatatcgtcggcatgccggcattcaaaattgctgaaatggccggt
atcaaagtgccgcaagatacaaaaatcctcatcgccgaattagaaggtgtaggtccggat
gacccgctgtccagagaaaaactgagccctgttttagcgtgctacaaagtcagcgggctt
gaagaaggattaaaacgcgccgaagagatgctggcgttcgggggaaccggccactcggcg
gtgattcatacgaacgatcaagaagccgttaaagaattcggcttaaggatgaaggccggc
cggatcattgtcaatgcaccgtcgtcacaaggagcgatcggcgacatttacaacgcctat
atgccttctttaacgctcggctgcggcacatatggcgggaactccgtctcgtcaaacgta
ggggccgttcatttaatcaacacgaaaaaagtggcgaaaaggaatgtcaatatgcagtgg
tttaaagtgcctccaaaaatctattttgaaaaacacgcaacccaatatttagcgaaaatg
cctgacatctcaaaagcgtttattgtgactgatccgggaatggtgaaactcggatatgta
gaccgcgcccttcactacttaagaaggcgcccggattacgttcattgcgaaattttttct
gatgtcgagcctgatccttcaatcgaaacggtgatgaacggcgtcgacatgatggccaaa
ttccagccggatgtcatcatcgccctcggcggaggttcggcaatggatgccgcaaaagga
atgtggatgttctacgagcaccctgatgctgaattctttggcttaaagcaaaaatttctg
gacatccgcaagcgcatcgtcaaatacccgaaactgggaggaaaagcaaaattcgtcgca
atcccgacgacatcaggcacaggttctgaagtcacttcattctctgtcattacagacaaa
gaaacgaatacaaagtacccgctggccgattatgaattaacaccggatgtcgcgatcatt
gacccgcaatttgtcatgaccgtgccgaaacatatcacggccgacacaggaatggacgta
ttgacacacgcaattgaatcatacgtatcgtgcatggccaacgactatactgacggcttg
gccatgaaggccatccagctgatcttcgaatatctgccaagagcatacaaaaacggcagc
gacgagctggcccgcgaaaaagtgcataatgcatcaacgattgccggaatggcattttcc
aatgccttcctcggcatcaaccacagcttagcccataagcttggcgccgagtttcagatc
gctcatggacgggcaaacgccatccttctgccgcacgtgatccgctataatgcagcgaag
ccgaaaaagttcacggcatttcctaaatacagccacttcatagccgaccagcgctacgcg
gagattgccagaacgctcggcctgcctgcaaaaacaactgcagaaggtgttgaaagcctc
atccaggagatcatctcgcttgccaaagagcttaaaattccgatgagcattaaacaaaac
ggcgtggatgccgccgcattcgaaagcaaagtagatctcatggccgagcgcgcctttgaa
gatcagtgcacgacagccaatcctaagctgccgctcgtttcagagctggctgagatttac
cgttccgcgtataaaggagtttag

DBGET integrated database retrieval system