KEGG   Bacillus licheniformis ATCC 14580: BL00264Help
Entry
BL00264           CDS       T00197                                 

Gene name
lacA
Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BL00264 (lacA)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BL00264 (lacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4120287..4122341)
Genome map
AA seq 684 aa AA seqDB search
MPKIYTTQARYMLHGGDYNPDQWLDRPDILADDIKLMKLAHTNTFSVGIFSWSALEPEEG
VYTFEWLDDIFESIHRNGGRIILATPSGARPAWLSQKYPEVLRVNAERVKQLHGGRHNHC
FTSYVYREKTKEINRMLAERYGSQHALLMWHVSNEYGGECHCDQCQHAFRDWLKKKYNHD
IKSLNDAWWTPFWSHTFNDWSQIESPSPIGENAVHGLNLDWRRFVTDQTISFFQNEIVPL
KEITPNIPITTNFMADTHDLIPFQGLDYSKFAKHLDVISWDAYPAWHNDWESTADLAMKV
GFINDLYRSLKQQPFLLMESTPSAVNWHDFNKAKRPGMHLLSSVQMIAHGSDSILYFQWR
KSRGSSEKFHGAVVGHDNCSENRVFKEVAKVGQTLEALSEVTGTIRPADVAILYDWENHW
ALQDAQGFGMKTKRYPQTLHEHYRAFWERDIPVDVITKEQDFSSYRLLIVPMLYLASEET
IARLKAFAANGGTLVMTYISGIVNESDLTYLGGWPKDLQEMFGMEPVETDTLYPGDKNAV
RYQNRSYELKDYATVLKLSTADPEGFYEDDFYADTTAVTSHPYKQGKTYYIGARLSSQFH
RDFYGTLIKELAIQPALDVKHQPGVSVQVRQDEENDYIFIMNFTEKRQPVVLASAVKDML
TGETLAGEVTLEKYEARIAVKAKE
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaatttatacgacccaagcaagatacatgcttcacgggggagactacaatccg
gatcagtggcttgaccgtccggatattcttgcagatgacatcaagctgatgaagcttgcc
catacgaatacattttcagtggggattttttcatggagcgcccttgagccggaggaaggc
gtctatacgtttgaatggctggatgatatttttgagagcattcaccggaacggcggccgg
attatattggcgacaccgagcggcgcccgtcctgcttggctgtcgcaaaagtatccggaa
gtgctgcgcgtgaatgctgaacgcgtcaaacagctgcacggcggaaggcacaatcattgc
ttcacttcatacgtataccgtgaaaaaacgaaagagatcaaccgcatgctggctgaaagg
tacggcagccagcatgcccttttgatgtggcatgtttccaacgaatacggaggagaatgc
cattgtgatcaatgtcagcacgccttcagagactggctgaaaaagaagtacaaccatgat
attaaatctttgaatgacgcatggtggacgcctttttggagccacaccttcaacgattgg
tcacagattgaatcgccgtctccgatcggggaaaatgcggtgcacggcttgaatttagac
tggcgacgcttcgtcactgaccagacgatctctttttttcaaaatgaaatcgttccgtta
aaggaaatcacgccgaatattccgattacgaccaattttatggcggacacgcatgattta
attccgtttcaagggctggactacagcaagtttgccaagcacctggacgtgatcagctgg
gacgcgtatcccgcctggcacaacgattgggaaagcacagcagatttggccatgaaagtc
ggctttatcaatgatttgtaccgcagcctgaaacagcagccgtttctcttaatggaatcg
acgccaagcgctgtcaattggcacgattttaataaagcgaaacggccgggcatgcacctc
ctgtcttctgtgcagatgatcgcacacggatctgacagcatcctctattttcaatggcgg
aaatcccgcggctcatcggaaaaatttcatggtgcggttgtcggccatgacaattgttcc
gagaaccgcgtgtttaaagaagtggcaaaagtcgggcaaacccttgaagcgctgtctgaa
gtcaccggaacgatccggcctgcggatgtcgcgattctctacgattgggaaaaccattgg
gcgctccaagatgcacaaggattcgggatgaaaaccaagcggtatccccaaaccctgcac
gagcactaccgcgcgttttgggagcgtgatattccagtcgacgtgattacgaaggaacag
gatttttcatcgtaccggctgctgatcgttccgatgctttacttagcaagcgaagaaaca
atcgcgcgcttaaaggcatttgctgccaacgggggcacattggtgatgacctatattagc
ggaatcgtcaacgaatctgatctgacctatttaggcggatggccaaaagatctgcaagag
atgtttggcatggagcctgttgaaaccgatacactctatccgggcgataaaaatgcggtc
cgttatcaaaaccggtcgtatgagctgaaagattacgcgaccgtgctgaagctcagtacg
gcagatcccgagggattctatgaggacgacttttatgcggacacgacggctgtgacgagc
catccatacaaacaggggaaaacgtattatatcggtgcgcgtttaagcagccaatttcat
cgggatttttatggaacattgattaaagagctagcgattcaaccggctcttgacgtgaaa
catcagcctggcgtctccgttcaagtcagacaggatgaggaaaatgactatattttcatc
atgaatttcacggaaaaacgtcagcccgtcgtgttggcgtcggcagttaaagatatgctg
accggagaaacgctggccggcgaagtcacattggaaaaatatgaggccagaatagcggta
aaagcaaaagaatag

DBGET integrated database retrieval system