KEGG   Bacillus licheniformis ATCC 14580: BL00329Help
Entry
BL00329           CDS       T00197                                 

Gene name
ysiB
Definition
enoyl-CoA hydratase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bli01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bli00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2882716..2883492)
Genome map
AA seq 258 aa AA seqDB search
MAALSYAVDGHVATITIQHPPANALSTQVLEDLSACLDELSERQDVRSVVIHGEGRFFSA
GADIKEFTSLMDGSDYANLADKGQQIFEKVESFPKPVIAAIHGAALGGGLELAMACHIRI
AEESAKLGLPELNLGIIPGFAGTQRLPKYVGTAKALEMIGTSEPISGKEAFEYGLVTILA
ANEEEVLQKAKELAQKFAEKSPQTMAYVIELLNSSKVYSYEGGLKLEGKYFGEVFQSEDA
KEGIQAFLEKRKPHFKGK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcagcattatcatacgccgtagacggccatgttgcgacgattacgattcagcacccg
ccggcaaatgcgctatcgacgcaagtgcttgaagatctttcggcatgccttgatgaactt
tcagaacgtcaggatgtcagaagcgtcgttattcacggggaaggaagatttttctcggca
ggcgctgatattaaagagtttacatcattgatggacgggtctgattatgcaaatttggct
gataagggccagcagattttcgaaaaagtagaatcttttccaaaaccggtgatcgccgcg
attcacggggccgctcttggaggcggtcttgagctagcgatggcatgccacatccggatt
gccgaggaaagcgcaaagctcggccttcccgaactgaatctcggaatcattcccggcttt
gcgggaacgcagcgccttcccaagtatgtgggcaccgccaaagcgcttgaaatgatcggg
acatcagagccgatatccggcaaggaagcttttgaatacggtcttgtcacgattttggcg
gcgaatgaagaagaagtgctgcaaaaggcaaaagagctcgcacaaaaattcgctgaaaaa
agtccgcagacgatggcttatgtcattgaactcctgaattcgagcaaagtgtattcgtat
gaaggaggcctcaagctagaagggaaatacttcggcgaagtgttccaatccgaggatgcg
aaggaagggattcaggcatttcttgaaaagcggaagccgcattttaaagggaaataa

DBGET integrated database retrieval system