KEGG   Bacillus licheniformis ATCC 14580: BL00329Help
Entry
BL00329           CDS       T00197                                 

Gene name
ysiB
Definition
(GenBank) Enoyl-CoA hydratase/isomerase YsiB
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00071  Fatty acid degradation
bli00362  Benzoate degradation
bli01100  Metabolic pathways
bli01120  Microbial metabolism in diverse environments
bli01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BL00329 (ysiB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BL00329 (ysiB)
Enzymes [BR:bli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BL00329 (ysiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AAU24508
UniProt: Q65GE6
Position
complement(2882716..2883492)
Genome map
AA seq 258 aa AA seqDB search
MAALSYAVDGHVATITIQHPPANALSTQVLEDLSACLDELSERQDVRSVVIHGEGRFFSA
GADIKEFTSLMDGSDYANLADKGQQIFEKVESFPKPVIAAIHGAALGGGLELAMACHIRI
AEESAKLGLPELNLGIIPGFAGTQRLPKYVGTAKALEMIGTSEPISGKEAFEYGLVTILA
ANEEEVLQKAKELAQKFAEKSPQTMAYVIELLNSSKVYSYEGGLKLEGKYFGEVFQSEDA
KEGIQAFLEKRKPHFKGK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcagcattatcatacgccgtagacggccatgttgcgacgattacgattcagcacccg
ccggcaaatgcgctatcgacgcaagtgcttgaagatctttcggcatgccttgatgaactt
tcagaacgtcaggatgtcagaagcgtcgttattcacggggaaggaagatttttctcggca
ggcgctgatattaaagagtttacatcattgatggacgggtctgattatgcaaatttggct
gataagggccagcagattttcgaaaaagtagaatcttttccaaaaccggtgatcgccgcg
attcacggggccgctcttggaggcggtcttgagctagcgatggcatgccacatccggatt
gccgaggaaagcgcaaagctcggccttcccgaactgaatctcggaatcattcccggcttt
gcgggaacgcagcgccttcccaagtatgtgggcaccgccaaagcgcttgaaatgatcggg
acatcagagccgatatccggcaaggaagcttttgaatacggtcttgtcacgattttggcg
gcgaatgaagaagaagtgctgcaaaaggcaaaagagctcgcacaaaaattcgctgaaaaa
agtccgcagacgatggcttatgtcattgaactcctgaattcgagcaaagtgtattcgtat
gaaggaggcctcaagctagaagggaaatacttcggcgaagtgttccaatccgaggatgcg
aaggaagggattcaggcatttcttgaaaagcggaagccgcattttaaagggaaataa

DBGET integrated database retrieval system