KEGG   Bacillus licheniformis ATCC 14580: BL00354Help
Entry
BL00354           CDS       T00197                                 

Gene name
ysdC
Definition
(GenBank) peptidase M42 family YsdC
Organism
bli  Bacillus licheniformis ATCC 14580
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2916878..2917963)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLMMLKELTDAKGIPANEKEPRQVMKSYIEPFADEVTTDRLGSLIAKKTGQADG
PKIMIAGHLDEVGFMVTRIDDRGYLRFQTVGGWWSQVMLAQRVTVVTKKGDITGIIGSKP
PHVLSQEARKKSVDIKDMFIDIGASSREEAMEWGVLPGDQVVPYFEFTVMNNEKMLLAKA
WDNRIGCAIAIDVLKNLKGADHPNVVYGVGTVQEEVGLRGAKTAAHTIKPDIAFGVDVGI
AGDTPGITEKESASKMGKGPQIILYDASMVSHKGLRDFVTNVADEAGIPYQFDALSGGGT
DSGSIHLTANGVPALSITIATRYIHTHAAMLHRDDYEHAVKLITEVIKRLDKETVQNITF
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcttgatgaaacattgatgatgctaaaggaattaactgatgcaaaaggaatt
ccggcgaatgaaaaagaacccagacaagtcatgaaatcgtacatagaaccgtttgccgac
gaggttacgacagacagactgggaagcttaatcgcaaaaaagactggacaggctgacgga
ccgaagattatgattgccggccatcttgatgaggtcggttttatggttacgcggatcgat
gacaggggctatctccgctttcagacggtcggaggctggtggagccaggtcatgctggcg
cagcgtgtgacggtcgtgacaaagaaaggcgacatcaccggtatcatcggttcaaagcct
cctcatgtcctgtctcaggaggcgagaaaaaaatcggtcgatattaaagatatgtttatc
gacatcggggcgtcgagcagggaggaagcgatggaatggggcgttcttccgggagaccag
gtcgtcccttactttgaatttacggtgatgaataatgaaaaaatgctgcttgccaaagca
tgggacaaccgtatcggctgcgcgatcgcaatcgacgtgctgaaaaacctgaaaggagcc
gatcatccgaatgtcgtctacggcgtcggaaccgtacaagaggaagtagggctgagaggc
gcgaaaacagccgcgcatacgatcaagcctgatatcgctttcggtgtcgacgtgggaatt
gcgggtgatacgcctggtattaccgaaaaagagtcggcaagcaaaatgggaaaaggcccg
cagatcatactttatgatgcatcaatggtgtcccataaagggcttcgcgactttgtaacg
aatgtggcagatgaagccggcattccgtatcaatttgacgccctctcaggcggaggaaca
gattcaggatcaatccaccttaccgcgaacggagtgcctgccctgtcgatcacgatcgcg
acgaggtatatccatacgcacgcggccatgcttcaccgggatgactatgaacatgcggta
aaattaattaccgaagtcattaaacgactggataaagagacggttcaaaacattacgttt
gactga

DBGET integrated database retrieval system