KEGG   Bacillus licheniformis ATCC 14580: BL00354Help
Entry
BL00354           CDS       T00197                                 

Gene name
ysdC
Definition
M42 family peptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BL00354 (ysdC)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BL00354 (ysdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2916878..2917963)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLMMLKELTDAKGIPANEKEPRQVMKSYIEPFADEVTTDRLGSLIAKKTGQADG
PKIMIAGHLDEVGFMVTRIDDRGYLRFQTVGGWWSQVMLAQRVTVVTKKGDITGIIGSKP
PHVLSQEARKKSVDIKDMFIDIGASSREEAMEWGVLPGDQVVPYFEFTVMNNEKMLLAKA
WDNRIGCAIAIDVLKNLKGADHPNVVYGVGTVQEEVGLRGAKTAAHTIKPDIAFGVDVGI
AGDTPGITEKESASKMGKGPQIILYDASMVSHKGLRDFVTNVADEAGIPYQFDALSGGGT
DSGSIHLTANGVPALSITIATRYIHTHAAMLHRDDYEHAVKLITEVIKRLDKETVQNITF
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcttgatgaaacattgatgatgctaaaggaattaactgatgcaaaaggaatt
ccggcgaatgaaaaagaacccagacaagtcatgaaatcgtacatagaaccgtttgccgac
gaggttacgacagacagactgggaagcttaatcgcaaaaaagactggacaggctgacgga
ccgaagattatgattgccggccatcttgatgaggtcggttttatggttacgcggatcgat
gacaggggctatctccgctttcagacggtcggaggctggtggagccaggtcatgctggcg
cagcgtgtgacggtcgtgacaaagaaaggcgacatcaccggtatcatcggttcaaagcct
cctcatgtcctgtctcaggaggcgagaaaaaaatcggtcgatattaaagatatgtttatc
gacatcggggcgtcgagcagggaggaagcgatggaatggggcgttcttccgggagaccag
gtcgtcccttactttgaatttacggtgatgaataatgaaaaaatgctgcttgccaaagca
tgggacaaccgtatcggctgcgcgatcgcaatcgacgtgctgaaaaacctgaaaggagcc
gatcatccgaatgtcgtctacggcgtcggaaccgtacaagaggaagtagggctgagaggc
gcgaaaacagccgcgcatacgatcaagcctgatatcgctttcggtgtcgacgtgggaatt
gcgggtgatacgcctggtattaccgaaaaagagtcggcaagcaaaatgggaaaaggcccg
cagatcatactttatgatgcatcaatggtgtcccataaagggcttcgcgactttgtaacg
aatgtggcagatgaagccggcattccgtatcaatttgacgccctctcaggcggaggaaca
gattcaggatcaatccaccttaccgcgaacggagtgcctgccctgtcgatcacgatcgcg
acgaggtatatccatacgcacgcggccatgcttcaccgggatgactatgaacatgcggta
aaattaattaccgaagtcattaaacgactggataaagagacggttcaaaacattacgttt
gactga

DBGET integrated database retrieval system