KEGG   Bacillus licheniformis ATCC 14580: BL00393Help
Entry
BL00393           CDS       T00197                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bli03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2939622..2940449)
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETVRRTLAGLVRGKTIDAVDVRWTKIIKRPEEPEEFARLLAGQTIQSIGRRGK
FLLFHLDDCVMVSHLRMEGKYGLHQNDEPLDKHVHVIFRFTDGSELRYRDVRKFGTMHLF
KPGEELTELPLRQLGPEPFSSEFTADYLRERLKKTNRSVKTALLDQRTVVGLGNIYVDEA
LFRAGIHPEATANKLTKKQTVLLHKEIIQTLKEAVEAGGSTVRSYINSQGEIGMFQLKLF
VYGRKDEPCKKCGSPIEKTVVGGRGTHFCIKCQKK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgccggaattaccagaagtcgaaacggtccggcgcactcttgccgggcttgtaagaggg
aaaacgatcgatgcggttgatgtcagatggacaaaaatcataaaacgtccggaggagcct
gaggaattcgcaaggctcctggccggccagacgattcagtcgatcggaagaaggggaaaa
ttcctgttgtttcatcttgatgattgtgtcatggtttcccatttgagaatggaaggaaag
tacgggcttcatcaaaacgatgaaccccttgataaacatgtgcacgtcattttcaggttc
acggacggaagcgagctgcgctaccgggatgtcagaaagttcggcaccatgcatttgttt
aagccgggagaggaactgacagagctgcctctcaggcagctcggccccgagcccttcagc
agcgaatttacagccgattacttaagagagcgcctgaagaaaacaaaccgctcggtgaaa
accgcgctgctcgatcagcggacagtcgtcggactgggcaatatttatgtcgacgaggct
ttgttcagagccggtatccatcccgaggcaacagcgaacaagctcacaaaaaaacagacg
gttcttctccataaagagatcattcaaacgttaaaggaagctgttgaagcagggggaagc
acagtcagatcttacatcaattcacaaggtgagatcggcatgttccagctcaaacttttc
gtttacggcaggaaagatgaaccttgtaaaaaatgcggatctccaattgaaaaaacagtc
gttggcggaaggggcacgcatttttgcataaagtgccagaaaaaatga

DBGET integrated database retrieval system